DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and ncam2

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_571905.1 Gene:ncam2 / 114441 ZFINID:ZDB-GENE-010822-1 Length:795 Species:Danio rerio


Alignment Length:394 Identity:75/394 - (19%)
Similarity:120/394 - (30%) Gaps:146/394 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NLLFFTQVLTVLSSTIKYNEYATDKGGNVSIPCIAQG----NIMWVK-----EHGNNSTIVQTGR 70
            |::....|..|:|...:......|.|.:|:..|.|.|    ::.|.:     :......:...|.
Zfish   198 NIILVVNVPPVVSVPQQSFNATADYGESVTFTCRAYGSPEPDVTWHRKGVQLQESERYVMRARGT 262

  Fly    71 VLVLRNVSTTDAGIYVCFAS--------------VPRPSTT----ATSATTSPQNLQDK-ETRPL 116
            .|.:||:...|.|.|.|.||              ..:|..|    .|:...|...:..| |..||
Zfish   263 TLTVRNIQQDDGGSYTCRASNKAGEVEHELFLKVFVQPHITKLRNVTAVEGSAAMISCKAEGEPL 327

  Fly   117 ED-----EDDGQGESVSPKDDQLKEAEMEEEVEYLAHQRTKLIVR-------------TVPGPVS 163
            .:     ..||...|   ..|:..:..:|....|.....|.::|:             .:.|...
Zfish   328 PEISWRRASDGHSFS---DGDKSPDGRVEVRGRYGESMLTIVVVKLSDWGRFDCEALSRIGGHQK 389

  Fly   164 QLY--------FKASTILGF--------------------LIWRFNK---TQSGGYPVRSFTAEY 197
            .::        |:|:..:.|                    ::||..|   ...|...:|.:||..
Zfish   390 SMFLDIEYAPKFQANHTIFFSWEGNPVNISCDVMSNPPATMLWRREKLTIPSEGAGNMRVYTAPG 454

  Fly   198 RNVSYKTPPANASF----------------EHAWSRMDPINIAFNVRQMEV-------------- 232
            |::...||.::..|                |...::.|..:..::||...|              
Zfish   455 RSLLEVTPMSDRDFGRYNCTARNNIGMRFQEFILAQADVPSNPYSVRLSSVAQRVATVTFTKPDS 519

  Fly   233 ------------YR-----------------------LAPNTTYEFRIWANNELGSGEVV-TTNV 261
                        |:                       |.||||||.|:.|.|..|.||.. |.:.
Zfish   520 HGGVPISHYLVKYKDISSQDWKDVKSLGTQTIVLLTNLEPNTTYEVRVSAVNGKGQGEFSHTESF 584

  Fly   262 TTLP 265
            .|||
Zfish   585 QTLP 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 14/59 (24%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 0/3 (0%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
ncam2NP_571905.1 IgI_1_NCAM-2 20..112 CDD:409452
Ig strand A 20..25 CDD:409452
Ig strand A' 28..32 CDD:409452
Ig strand B 34..44 CDD:409452
Ig strand C 48..54 CDD:409452
Ig strand C' 57..59 CDD:409452
Ig strand D 65..71 CDD:409452
Ig strand E 73..81 CDD:409452
Ig strand F 88..95 CDD:409452
Ig strand G 100..111 CDD:409452
Ig 131..194 CDD:409353
Ig strand B 131..135 CDD:409353
Ig strand C 144..148 CDD:409353
Ig strand F 181..186 CDD:409353
IgI_1_MuSK 213..296 CDD:409562 17/82 (21%)
Ig strand A' 215..220 CDD:409562 0/4 (0%)
Ig strand B 226..233 CDD:409562 2/6 (33%)
Ig strand C 239..244 CDD:409562 1/4 (25%)
Ig strand C' 246..248 CDD:409562 0/1 (0%)
Ig strand D 255..258 CDD:409562 0/2 (0%)
Ig strand E 262..268 CDD:409562 1/5 (20%)
Ig strand F 275..282 CDD:409562 3/6 (50%)
Ig strand G 288..296 CDD:409562 0/7 (0%)
Ig 298..395 CDD:472250 17/99 (17%)
Ig strand B 316..320 CDD:409353 0/3 (0%)
Ig strand C 329..333 CDD:409353 0/3 (0%)
Ig strand E 361..365 CDD:409353 0/3 (0%)
Ig strand F 375..380 CDD:409353 0/4 (0%)
Ig strand G 388..391 CDD:409353 0/2 (0%)
IG_like 411..488 CDD:214653 12/76 (16%)
Ig strand B 416..420 CDD:409353 0/3 (0%)
Ig strand C 429..433 CDD:409353 0/3 (0%)
Ig strand E 456..460 CDD:409353 0/3 (0%)
Ig strand F 470..475 CDD:409353 0/4 (0%)
FN3 <487..>675 CDD:442628 22/102 (22%)
FN3 494..586 CDD:238020 18/91 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.