DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and CHL1

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_006605.2 Gene:CHL1 / 10752 HGNCID:1939 Length:1224 Species:Homo sapiens


Alignment Length:259 Identity:57/259 - (22%)
Similarity:90/259 - (34%) Gaps:71/259 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IMWVKE------HG-NNSTIVQTGRVLVLRNVSTTDAGIYVCFASVPRPS------TTATSATTS 104
            :.|.|:      :| .:..|:..|..|.:.||:..|.|||.|.|.....|      .|.......
Human   566 LSWSKDGEAFEINGTEDGRIIIDGANLTISNVTLEDQGIYCCSAHTALDSAADITQVTVLDVPDP 630

  Fly   105 PQN--LQDKETRPLE-------DEDDGQGESVSPKDDQLKEAEMEEEVEYLAHQRTKLIVRTVPG 160
            |:|  |.:::.|.:.       |.:....|.:...:...:|....||:..:..::|.:|:...|.
Human   631 PENLHLSERQNRSVRLTWEAGADHNSNISEYIVEFEGNKEEPGRWEELTRVQGKKTTVILPLAPF 695

  Fly   161 PVSQLYFKASTILGFLIWRFNKTQSGGY------------------------------PVRSFT- 194
            ...|....|...:|    |...:|...:                              |::|.. 
Human   696 VRYQFRVIAVNEVG----RSQPSQPSDHHETPPAAPDRNPQNIRVQASQPKEMIIKWEPLKSMEQ 756

  Fly   195 ----AEYRNVSYKTPPANASFEHAWSRMDPINIAFNVRQMEVYRLAPNTTYEFRIWANNELGSG 254
                .||| |::|  |..|..|  |......|....|....||  ||   |:.::.|.|:||||
Human   757 NGPGLEYR-VTWK--PQGAPVE--WEEETVTNHTLRVMTPAVY--AP---YDVKVQAINQLGSG 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 13/43 (30%)
Ig strand B 43..47 CDD:409358
Ig strand C 52..56 CDD:409358 0/2 (0%)
Ig strand F 84..89 CDD:409358 3/4 (75%)
CHL1NP_006605.2 Ig 35..126 CDD:472250
Ig strand B 53..57 CDD:409396
Ig strand C 66..70 CDD:409396
Ig strand E 90..94 CDD:409396
Ig strand F 106..111 CDD:409396
Ig strand G 120..123 CDD:409396
IgI_2_L1-CAM_like 135..225 CDD:409432
Ig strand A 135..138 CDD:409432
Ig strand A' 140..144 CDD:409432
Ig strand B 147..155 CDD:409432
Ig strand C 162..168 CDD:409432
Ig strand C' 171..174 CDD:409432
Ig strand D 180..184 CDD:409432
Ig strand E 186..190 CDD:409432
Ig strand F 201..209 CDD:409432
Ig strand G 212..225 CDD:409432
Ig3_L1-CAM_like 262..344 CDD:409394
Ig strand B 274..278 CDD:409394
Ig strand C 287..291 CDD:409394
Ig strand E 309..313 CDD:409394
Ig strand F 323..328 CDD:409394
Ig strand G 336..339 CDD:409394
Ig4_L1-NrCAM_like 348..435 CDD:409367
Ig strand B 364..368 CDD:409367
Ig strand C 377..381 CDD:409367
Ig strand E 400..404 CDD:409367
Ig strand F 414..419 CDD:409367
Ig strand G 427..430 CDD:409367
Ig 448..525 CDD:472250
Ig strand B 457..461 CDD:409390
Ig strand C 470..474 CDD:409390
Ig strand E 493..497 CDD:409390
Ig strand F 507..512 CDD:409390
Ig strand G 520..523 CDD:409390
Ig 548..617 CDD:409353 15/50 (30%)
Ig strand B 548..552 CDD:409353
Ig strand C 565..569 CDD:409353 0/2 (0%)
DGEA 571..574 0/2 (0%)
Ig strand E 590..594 CDD:409353 1/3 (33%)
Ig strand F 604..609 CDD:409353 3/4 (75%)
FN3 <616..>868 CDD:442628 42/209 (20%)
FN3 628..717 CDD:238020 17/92 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 709..732 3/26 (12%)
FN3 834..927 CDD:238020
FN3 932..1027 CDD:238020
Bravo_FIGEY 1120..1205 CDD:464016
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1147..1179
FIG[AQ]Y 1197..1201
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1205..1224
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.