DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15312 and chl1b

DIOPT Version :10

Sequence 1:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_017212175.2 Gene:chl1b / 100318566 ZFINID:ZDB-GENE-091105-1 Length:1294 Species:Danio rerio


Alignment Length:438 Identity:85/438 - (19%)
Similarity:134/438 - (30%) Gaps:158/438 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KGGNVSIPCIAQG----NIMWVKEHGN---NSTIVQT-GRVLVLRNVSTTDAGIYVCFASVPRPS 95
            ||.::.:.|||:|    .:.|||...|   ...:|:: |::|.:..|:..|.|.|:|.|..|...
Zfish   275 KGEDLQLECIAEGFPTPKVEWVKIGFNKLPERVVVESHGKLLTVEMVNEEDEGKYMCRAKNPHGE 339

  Fly    96 TTATSATTSPQNLQDKETRPLEDEDDGQGESVSPKDDQLKEAEMEEEVEYLAHQRTKLIVRTVPG 160
            .......|..:        |.|.|.:.|.:.|:...|.|                .|.:|:..|.
Zfish   340 VVHHFHVTVEE--------PPEFEIEPQSQLVTIGADVL----------------IKCVVKGNPQ 380

  Fly   161 PV----------------SQLYFKASTILGFLIWRFNKTQSGGYP-------------------- 189
            |.                ::...|..||   .|...|...|..|.                    
Zfish   381 PTVGWRVNGRPLNEVPTSNRKILKDGTI---SIHNANPENSAVYQCEATNKHGTILANANIMIMN 442

  Fly   190 VRSFTAEYRNVSYKTPPANASFEH-----------AWSRMDPINIA----FNVRQ---MEVYRLA 236
            ::.......|:.|......:...|           .||:.|..|..    |.|.|   :|::.:.
Zfish   443 IQPLILTENNLQYMAVEGKSVVMHCKVFSSPASSITWSKADSANAVEGERFTVHQNGSLEIHNVM 507

  Fly   237 PNTTYEFRIWANNELGSGEVVTTNVTTLPETKEEDLIRLIKPDLDNFDPRIWIVAVSIVLGTLVI 301
            .....|:..:|.|..|...:..|       .:.:|..|::.|..|          :.::.||.:.
Zfish   508 KEDMGEYSCFAQNTEGKVAIAAT-------LEVKDPTRIVDPPRD----------LRVLAGTTIQ 555

  Fly   302 LAIGLCIVLSKECYQSAQMELQDGW-DSIELIPNIILNPGFSESDG----GPEPGG--------Q 353
            .              |.|.|....: |..|::         .|.||    |.|.|.        :
Zfish   556 F--------------SCQPEFDPSFGDDFEVL---------WEKDGIALNGSEDGRYILEDGVLE 597

  Fly   354 GHGGSAGDQD-----AGEDDDDDVAM----------PFPRTIIFGQHH 386
            ....|.|||.     |....|.|||:          | |..:|..:|:
Zfish   598 IINVSFGDQGFYACVARTPVDQDVAVAQLSVVDVPDP-PEDVILSEHN 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15312NP_001245603.1 Ig 39..90 CDD:472250 18/58 (31%)
Ig strand B 43..47 CDD:409358 0/3 (0%)
Ig strand C 52..56 CDD:409358 0/3 (0%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
chl1bXP_017212175.2 Ig 42..135 CDD:472250
Ig strand B 61..65 CDD:409396
Ig strand C 74..78 CDD:409396
Ig strand E 99..103 CDD:409396
Ig strand F 115..120 CDD:409396
Ig strand G 129..132 CDD:409396
Ig 144..234 CDD:472250
Ig strand B 158..162 CDD:409432
Ig strand C 172..176 CDD:409432
Ig strand E 195..199 CDD:409432
Ig strand F 210..215 CDD:409432
Ig strand G 226..229 CDD:409432
Ig 267..348 CDD:472250 20/72 (28%)
Ig strand B 279..283 CDD:409394 0/3 (0%)
Ig strand C 292..296 CDD:409394 0/3 (0%)
Ig strand E 314..318 CDD:409394 1/3 (33%)
Ig strand F 328..333 CDD:409394 2/4 (50%)
Ig strand G 341..344 CDD:409394 0/2 (0%)
Ig 359..438 CDD:472250 15/97 (15%)
Ig strand B 369..373 CDD:409367 1/19 (5%)
Ig strand C 382..386 CDD:409367 0/3 (0%)
Ig strand E 406..410 CDD:409367 2/6 (33%)
Ig strand F 420..425 CDD:409367 1/4 (25%)
Ig strand G 433..436 CDD:409367 0/2 (0%)
Ig 447..533 CDD:472250 16/92 (17%)
Ig strand B 463..467 CDD:409544 0/3 (0%)
Ig strand C 476..480 CDD:409544 0/3 (0%)
Ig strand E 499..503 CDD:409544 0/3 (0%)
Ig strand F 513..518 CDD:409544 1/4 (25%)
Ig strand G 526..529 CDD:409544 0/2 (0%)
Ig 535..635 CDD:472250 27/133 (20%)
Ig strand B 554..558 CDD:409359 0/17 (0%)
Ig strand C 571..575 CDD:409359 1/12 (8%)
Ig strand E 594..598 CDD:409359 0/3 (0%)
Ig strand F 608..613 CDD:409359 0/4 (0%)
Ig strand G 621..624 CDD:409359 2/2 (100%)
FN3 632..722 CDD:238020 4/14 (29%)
FN3 <702..1101 CDD:442628
FN3 1070..1142 CDD:214495
Bravo_FIGEY 1196..1279 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.