DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and Liph

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_038944552.1 Gene:Liph / 681694 RGDID:1592849 Length:476 Species:Rattus norvegicus


Alignment Length:207 Identity:59/207 - (28%)
Similarity:96/207 - (46%) Gaps:23/207 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 TSSEEDYSEEVKNA--KTQSGDIIVID--LGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELDM 244
            |.|...:.||:..:  ..|..:::|:|  .|:....|. :|.....|....:.::|.||:.: ..
  Rat   118 TGSPPVWMEELVQSLISVQEMNVVVVDWNRGATTVIYP-HASSKTRKVALILKEFIDQMLAK-GA 180

  Fly   245 PFDTIHLIGQNVGAHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAI 309
            ..|.|::||.::|||:||...:.::    .||.|:|||||:..:...:.....|...||:|||.|
  Rat   181 SLDNIYMIGVSLGAHIAGFVGEMYS----GKLGRITGLDPAGPLFNGRPPEDRLDPSDAQFVDVI 241

  Fly   310 HTSVYGMGTPIRSGDVDFYPNGPAAGVPGASNVV---------EAAMRATRYFAESVRPGNERSF 365
            |:....:|.....|.:|||||| ....||....:         :..|....|.| |::  |..|.
  Rat   242 HSDTDALGYREALGHIDFYPNG-GLDQPGCPKTIFGGIKYFKCDHQMSVFLYLA-SLQ--NNCSI 302

  Fly   366 PAVPANSLQQYK 377
            .|.|.:|.:.|:
  Rat   303 TAYPCDSYRDYR 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 59/207 (29%)
LiphXP_038944552.1 Pancreat_lipase_like 78..347 CDD:238363 59/207 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.