DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and CG34447

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster


Alignment Length:316 Identity:90/316 - (28%)
Similarity:138/316 - (43%) Gaps:68/316 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 YNLQQQRQ-----HGKNGNQDYQDQSNEQRKNQRTSSEEDYSEEVKNAKTQSGDIIVIDLGSKLN 214
            :|.|..|.     ||..|::|:  ..|...:......|:.|             :|.||.| .|.
  Fly    66 WNFQPPRPLKILIHGYTGDRDF--APNSYIRPVLLDHEDVY-------------VISIDYG-PLV 114

  Fly   215 TYERY--AMLDIEKTGAKIGKWIVQMVNELDMPFDTIHLIGQNVGAHVAGAAAQEFTRLTGHKLR 277
            .|..|  |:.::......:.:.|..:|:...:..|.|||||.::|..|||..|....|    |::
  Fly   115 RYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIHLIGFSLGGQVAGQTANYVKR----KMK 175

  Fly   278 RVTGLDPSK---IVAKSKNTLTGLARGDAEFVDAIHTSVYGMGTPIRSGDVDFYPNGPAAGVPGA 339
            |:|||||:|   |:......|.   :|||:|||.|||.|:|.|....:|.||||||. .|..||.
  Fly   176 RITGLDPAKPLFILGPDSRRLD---KGDADFVDVIHTDVFGRGYLRAAGHVDFYPNF-GAKQPGC 236

  Fly   340 --SNVVEAAM----RATRYFAESVRPGNERSFPAVPANSLQQY--KQNDGF-----------GKR 385
              .|:.:.:.    ||.|::|||:             |:...:  :|..|:           |.:
  Fly   237 MEENMQDPSSCNHERAPRFYAESI-------------NTTVGFWARQCSGWLLQLLTLCPTTGAQ 288

  Fly   386 AYMGIDTAHDLEGDYILQVNPKSPF--GRNAPAQKQSSYHGVHQAWNTNQDSKDYQ 439
            |.:|...:.:|.|.|.||...|||:  |:......:.:....|..::.|:...||:
  Fly   289 ALLGYHVSDELRGSYFLQTASKSPYALGKMQDVDNRQTLAKFHLNFDHNEIDDDYE 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 74/246 (30%)
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 82/279 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.