DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and pnliprp2

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001015812.1 Gene:pnliprp2 / 548529 XenbaseID:XB-GENE-5776210 Length:471 Species:Xenopus tropicalis


Alignment Length:236 Identity:59/236 - (25%)
Similarity:101/236 - (42%) Gaps:50/236 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 YERY--AMLDIEKTGAKIGKWIVQMVNELDMPFDTIHLIGQNVGAHVAGAAAQEFTRLTGHKLRR 278
            |..|  |..::...||::..:|..:.|:.......:|:||.::|:|.||...:   |..|  :.|
 Frog   130 YALYSQAANNVRVVGAEVAHFIQFLSNQYGYSAANVHVIGHSLGSHAAGETGK---RTPG--IAR 189

  Fly   279 VTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSV--------YGMGTPIRSGDVDFYPNGPAAG 335
            :|||||:....::......|.:.||:.||.|||..        :|:|..:  |.:|||||| ...
 Frog   190 ITGLDPAGPFFQNTPPEVRLDQSDAQLVDVIHTDASAIFPLTGFGIGQSV--GHLDFYPNG-GKN 251

  Fly   336 VPGASN-------------------VVEAAMRATRYFAESVRPGNERSFPAVPANSLQQYKQNDG 381
            :||...                   :..:.:|:.:::.||:...:  :|.|.|::..:.:|:..|
 Frog   252 MPGCKKSPTLKYLDNYRIFKGSKEIIFCSHIRSYKFYTESILTPD--AFVAFPSSDYKTFKKGTG 314

  Fly   382 F----GKRAYMGIDTAHDLEG------DYILQVNPKSPFGR 412
            |    |....|| ..|.:..|      .:.|......||.|
 Frog   315 FPCPSGGCPLMG-HYAEEFLGPTSGNLSFFLNTGNSEPFAR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 56/228 (25%)
pnliprp2NP_001015812.1 Lipase 18..352 CDD:278576 56/232 (24%)
PLAT 355..466 CDD:320707 59/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.