Sequence 1: | NP_001285071.1 | Gene: | Yp1 / 31939 | FlyBaseID: | FBgn0004045 | Length: | 439 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_056984.1 | Gene: | PLA1A / 51365 | HGNCID: | 17661 | Length: | 456 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 58/196 - (29%) |
---|---|---|---|
Similarity: | 85/196 - (43%) | Gaps: | 45/196 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 190 YSEEVKNAKTQSGDIIVIDLGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELDMPFDTIHLIGQ 254
Fly 255 NVGAHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSVYGMGTP 319
Fly 320 IRSGDVDFYPNG-------PAAGVPGASNVVEAAMRATRYFAESVRPGNERSFP--AVPANSLQQ 375
Fly 376 Y 376 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Yp1 | NP_001285071.1 | Abhydrolase | 183..406 | CDD:304388 | 58/196 (30%) |
PLA1A | NP_056984.1 | Lipase | 16..336 | CDD:278576 | 58/196 (30%) |
Pancreat_lipase_like | 49..332 | CDD:238363 | 58/196 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_28N19 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11610 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |