DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and PLA1A

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_056984.1 Gene:PLA1A / 51365 HGNCID:17661 Length:456 Species:Homo sapiens


Alignment Length:196 Identity:58/196 - (29%)
Similarity:85/196 - (43%) Gaps:45/196 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 YSEEVKNAKTQSGDIIVIDLGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELDMPFDTIHLIGQ 254
            |...|||         ||.|..:::.:              :.|.:|..|:|     .:||:||.
Human   129 YFSAVKN---------VIKLSLEISLF--------------LNKLLVLGVSE-----SSIHIIGV 165

  Fly   255 NVGAHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSVYGMGTP 319
            ::||||.|...|.|    |.:|.::|||||:.......:....|..|||.||:||||....:|..
Human   166 SLGAHVGGMVGQLF----GGQLGQITGLDPAGPEYTRASVEERLDAGDALFVEAIHTDTDNLGIR 226

  Fly   320 IRSGDVDFYPNG-------PAAGVPGASNVVEAAMRATRYFAESVRPGNERSFP--AVPANSLQQ 375
            |..|.||::.||       |.....|.|.::...|||...:..::    |.|.|  |.|..|.:.
Human   227 IPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLYISAL----ENSCPLMAFPCASYKA 287

  Fly   376 Y 376
            :
Human   288 F 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 58/196 (30%)
PLA1ANP_056984.1 Lipase 16..336 CDD:278576 58/196 (30%)
Pancreat_lipase_like 49..332 CDD:238363 58/196 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.