DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and CG6283

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster


Alignment Length:426 Identity:102/426 - (23%)
Similarity:165/426 - (38%) Gaps:106/426 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MRVLSLLACLAVAALAKPNGRMDNSVNQALKPSQWLSGSQLEAIPALDDFTIERLENMNLERGAE 68
            |:|..:||.|..|..|.|.....|..|      .|.       ||.||.    ..|.|:::...:
  Fly     1 MKVFFVLAALLAAVSALPIEERVNGEN------GWF-------IPKLDG----SFEWMDMQDAED 48

  Fly    69 LLQQVYHLSQIHHNVEPNYVPSGIQVYV-PKPNGDKTVAPLNEMIQRLKQKQNFGEDEVTIIVTG 132
            ||.   :.:|:...:..|.|  ...||. ..|...|.:...:..:    :..:|.:|.       
  Fly    49 LLA---NGAQMEGRISTNAV--NFYVYTKSNPTDGKEIKAKSGSV----EDSHFNKDH------- 97

  Fly   133 LPQTSETVKKATRKLVQAYMQRYNLQQQRQHGKNGNQDYQDQSNEQRKNQRTSSEEDYSEEVKNA 197
                      .||.::..:.|||:                               :|.:..:..|
  Fly    98 ----------GTRFVIHGWTQRYS-------------------------------DDMNTRITKA 121

  Fly   198 KTQSGD--IIVIDLGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELDMPFDTIHLIGQNVGAHV 260
            ....||  :||:|.....:.....::|.:...|.|:|:.|..:.:...:.:|::.:||.::||||
  Fly   122 WLSKGDYNVIVVDWARARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAHV 186

  Fly   261 AGAAAQEFTRLTGHK-LRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSVYGMG--TPIRS 322
            ||.|.    :..|.| :..:.||||:..:.........|:..||.:|::|.|:...:|  .||..
  Fly   187 AGYAG----KTVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKLGFLKPIGK 247

  Fly   323 GDVDFYPNG----PAAGVPGASNVVEAAMRATRYFAESVRPGNERSF------PAVPANSLQQYK 377
            |  .|||||    |..|:....:...|  |:..|:||:|...|..|.      .||..|....|.
  Fly   248 G--AFYPNGGKSQPGCGLDATGSCSHA--RSVLYYAEAVTEDNFGSIKCHDYEDAVAKNCGSTYS 308

  Fly   378 QNDGFGKRAYMG-IDTAHDLEGDYILQVNPKSPFGR 412
            .       ..|| |..|:.:|||:.:.||.::|||:
  Fly   309 S-------VRMGAITNAYMVEGDFYVPVNSEAPFGK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 65/238 (27%)
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 77/334 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445890
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.