DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and CG6295

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:328 Identity:82/328 - (25%)
Similarity:138/328 - (42%) Gaps:52/328 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 VTIIVTG-----LPQTSETVKKATRKLVQAYMQRYNLQQQR------------QHGKNGNQDYQD 173
            |.:.|.|     :||...|::...|:..:||::..|..:.|            ...:|..|:.:.
  Fly    18 VEVRVNGENGWYVPQADGTMEWMDREFAEAYLETKNRMEGRNVLNPVTFYLYTNSNRNSPQEIKA 82

  Fly   174 QS--------NEQRKNQRT------SSEEDYSEEVKNAKTQSGD--IIVIDLGSKLNTYERYAML 222
            .|        |.....:.|      |.:|..:..|::|....||  :|.:|.|...:.....::|
  Fly    83 TSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTHGDMNMIAVDWGRARSVDYASSVL 147

  Fly   223 DIEKTGAKIGKWIVQMVNELDMPFDTIHLIGQNVGAHVAGAAAQEFTRLTGHKLRRVTGLDPSKI 287
            .:...|.::...|..|.:...:..|...:||.::||||:|.|.:   .:...:|..:.||||:..
  Fly   148 AVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGK---NVKNGQLHTIIGLDPALP 209

  Fly   288 VAKSKNTLTGLARGDAEFVDAIHTS--VYGMGTPIRSGDVDFYPNG----PAAGVPGASNVVEAA 346
            :....:....|:..||.:|::|.|:  ..|...||..|  .|||||    |..||....:.  |.
  Fly   210 LFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKG--AFYPNGGKSQPGCGVDLTGSC--AH 270

  Fly   347 MRATRYFAESVRPGNERSFPAVPANSLQQ--YKQNDGFGKRAYMGIDT-AHDLEGDYILQVNPKS 408
            .|:..|:||||   .|.:||.:.....::  .|:.........||..| |:.:.|||.:.|...:
  Fly   271 SRSVIYYAESV---TENNFPTMRCGDYEEAVAKECGSSYSSVRMGATTNAYMVAGDYYVPVRSDA 332

  Fly   409 PFG 411
            |:|
  Fly   333 PYG 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 65/239 (27%)
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 69/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445891
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.