DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and CG6296

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster


Alignment Length:326 Identity:87/326 - (26%)
Similarity:141/326 - (43%) Gaps:60/326 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PQTSETVKKATRKLVQAYMQRYNLQQQRQHGKNGNQDYQDQSNEQRKNQRTSSEEDYSEEVKNAK 198
            |.|.:.:|.....:..::....|..:...||.|.|  |:|..|.:               |.:|.
  Fly    81 PSTGQQIKATQDSIDGSFFNPQNPTRITIHGWNSN--YKDGVNTR---------------VADAW 128

  Fly   199 TQSGD--IIVID--LGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNEL----DMPFDTIHLIGQN 255
            .|.||  :|.:|  .|..|    .||.......||  ||.:..:|:.|    .|..||:.::|.:
  Fly   129 FQYGDYNMIAVDWLRGRSL----EYASSVAGAPGA--GKKVAALVDFLVEGYGMSLDTLEIVGFS 187

  Fly   256 VGAHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHT--SVYGMGT 318
            :||||||..|::   :...|:.:|.||||:..:....||...|:..||.:|::|.|  ::.|.|.
  Fly   188 LGAHVAGHTAKQ---VNSGKVGKVVGLDPASPLISYSNTEKRLSSDDALYVESIQTNGAILGFGQ 249

  Fly   319 PIRSGDVDFYPNG----PAAG--VPGASNVVEAAMRATRYFAESVRPGNERSFPAVPA-NSLQQY 376
            ||  |...||.||    |..|  :.|:.:..:|.:    |:.|::...|   ||::.. :|:...
  Fly   250 PI--GKASFYMNGGRSQPGCGIDITGSCSHTKAVL----YYVEALLWNN---FPSIKCESSVDAN 305

  Fly   377 KQNDGFGKRAYMGIDTAHDL-----EGDYILQVNPKSPFGRNAPAQKQSSYHGVHQAWNTNQDSK 436
            |.|.|   ..|..:.....:     ||.:.:.||.:||:|.........:..|..:..:|..|.:
  Fly   306 KNNCG---NTYSSVFMGASINFFVAEGIFYVPVNKESPYGLGELNSGGEATTGTPEITSTTVDGE 367

  Fly   437 D 437
            |
  Fly   368 D 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 68/244 (28%)
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 79/293 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445894
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.