DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and CG4582

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster


Alignment Length:458 Identity:117/458 - (25%)
Similarity:174/458 - (37%) Gaps:119/458 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LKPSQWLSGSQLEAIPALDD--FTIERLENMNLERGAELLQQV-------YHL--SQIHHNVEPN 86
            |..|..:|..||   |.||:  ...|:||...|..|...::|.       |.|  |..||..   
  Fly    24 LLSSGLMSPGQL---PILDEQHGRQEQLERHYLAHGPSSVEQQLLRLQPDYKLLYSAEHHTY--- 82

  Fly    87 YVPSGIQVYVPKPNGDKTVAPL--------NEMIQRL-------------------KQKQNFGED 124
               ..:...||:.|.::...||        ..:.|::                   :|.|.|..:
  Fly    83 ---FHLHTLVPQDNANRQTGPLKSEKESPHRRLFQQVVGNTLTAAFGLNVMNKGDQEQNQQFTSE 144

  Fly   125 EVTII-VTGLPQTSETVKKATRKLVQAYMQRYNLQQQRQHGKNGNQDYQDQSNEQRKNQRTSSEE 188
            .|.:. ...|.::..:....||.|:              ||..||:      |....|:...:..
  Fly   145 PVNLYDAASLRRSRFSPFNPTRILI--------------HGWLGNE------NANMYNELLPAYF 189

  Fly   189 DYSEEVKNAKTQSGDIIVIDLGSKLNTYERYAMLD-------IEKTGAKIGKWIVQMVNELDMPF 246
            |    ::|.   :.:|..:|.|       |.|:.|       ::..|..:.|::..:..|..|.|
  Fly   190 D----LRNG---NYNIFTVDWG-------RGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRF 240

  Fly   247 DTIHLIGQNVGAHVAGAAAQEFTRLTGHKLRRVTGLDPSK---IVAKSKNTLTGLARGDAEFVDA 308
            :.:.|:|.::||||||.|.:...  || :||.:..|||:.   ..||.|..||.   .||::|:.
  Fly   241 EDLQLVGFSMGAHVAGLAGKHLQ--TG-RLRMIRALDPALPFFRYAKPKERLTA---EDADYVEV 299

  Fly   309 IHTSV--YGMGTPIRSGDVDFYPNGPAAGVPGASNVVEAAMRATRYFAESVRPGNERSF--PAVP 369
            :||||  ||...|:  |.||||.|. .:..||......:..||...||||:.......|  ...|
  Fly   300 LHTSVGSYGFDRPV--GHVDFYANW-GSQQPGCFWHECSHWRAFMLFAESLARDQATGFLSQGCP 361

  Fly   370 ANSLQQ----YKQNDGFGKRAYMGIDTAH-------DLEGDYILQVNPKSPFGRNAPAQKQSSYH 423
            |...||    ::.....|....||.|.|:       ..:|.|..|.|.:.|:   ..||..||..
  Fly   362 AAEWQQLTRFHRCPKDTGVMQTMGGDLANVSAEFLAQRQGVYYFQTNDQPPY---VLAQNASSKR 423

  Fly   424 GVH 426
            ..|
  Fly   424 AAH 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 71/247 (29%)
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 84/313 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445895
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.