DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and LIPC

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_005254431.2 Gene:LIPC / 3990 HGNCID:6619 Length:511 Species:Homo sapiens


Alignment Length:312 Identity:74/312 - (23%)
Similarity:125/312 - (40%) Gaps:72/312 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IIVTGLPQTSETVKKA---------------TRKLVQAYMQRYNLQQQRQHGKNGNQDYQDQSNE 177
            |::||:..:||.::||               |.|.:.....|:.|..:...|.....::.|...|
Human    22 ILITGVTTSSEDMRKAPVSEEPFGRRAQAVETNKTLHEMKTRFLLFGETNQGCQIRINHPDTLQE 86

  Fly   178 QRKNQRTS--------SEEDYSEE--------VKNAKTQSGDIIVIDLGSKLNTYERYAMLDIEK 226
            ...|....        |.:...|.        :|:...|..::.::|..:..:.:...|:.:...
Human    87 CGFNSSLPLVMIIHGWSVDGVLENWIWQMVAALKSQPAQPVNVGLVDWITLAHDHYTIAVRNTRL 151

  Fly   227 TGAKIG---KWIVQMVNELDMPFDTIHLIGQNVGAHVAGAAAQEFTRLTG-HKLRRVTGLDPSKI 287
            .|.::.   :|:.:.|   .:....:||||.::||||:|.|.   :.:.| ||:.|:||||.:..
Human   152 VGKEVAALLRWLEESV---QLSRSHVHLIGYSLGAHVSGFAG---SSIGGTHKIGRITGLDAAGP 210

  Fly   288 VAKSKNTLTGLARGDAEFVDAIHT--------SVYGMGTPIRSGDVDFYPNGPAAGVPGAS---- 340
            :.:.......|:..||.|||||||        || |:..||  |..|||||| .:..||..    
Human   211 LFEGSAPSNRLSPDDANFVDAIHTFTREHMGLSV-GIKQPI--GHYDFYPNG-GSFQPGCHFLEL 271

  Fly   341 ---------NVVEAAM-----RATRYFAESVRPGNERSFPAVPANSLQQYKQ 378
                     |.:...:     |:...|.:|:.....:|. |.|...:..:.|
Human   272 YRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSM-AYPCGDMNSFSQ 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 59/242 (24%)
LIPCXP_005254431.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.