DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and lipca

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:212 Identity:61/212 - (28%)
Similarity:100/212 - (47%) Gaps:32/212 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 KTQSGDIIVIDLGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELD----MPFDTIHLIGQNVGA 258
            |:..|:|.|: :...|....::..:..:.|.. :|:.|..:::.|:    .|...:||||.::||
Zfish   105 KSSEGNINVL-IADWLTLAHQHYPIAAQNTRI-VGQDIAHLLSWLEDFKQFPLGKVHLIGYSLGA 167

  Fly   259 HVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHT--------SVYG 315
            |::|.|..... ::|..|.|:|||||:..:.:..:....|:..||:|||||||        || |
Zfish   168 HISGFAGSNLA-MSGRTLGRITGLDPAGPMFEGMSHTDRLSPEDAKFVDAIHTFTLQRMGLSV-G 230

  Fly   316 MGTPIRSGDVDFYPNGPAAGVPGA----SNV-VEAAMRATRYFAESVRPGNERSFPAVPANSLQQ 375
            :..|:  ...|||||| .:..||.    .|: ...|......|.::|:..:||:......:.|.:
Zfish   231 IKQPV--AHFDFYPNG-GSFQPGCQLHMQNIYAHLAQHGIMGFEQTVKCAHERAVHLFIDSLLNK 292

  Fly   376 YKQ--------NDGFGK 384
            .||        |..|.|
Zfish   293 DKQIMAYKCSDNTAFDK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 61/212 (29%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 61/212 (29%)
Pancreat_lipase_like 54..344 CDD:238363 61/212 (29%)
PLAT_LPL 351..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.