DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and CG10163

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster


Alignment Length:365 Identity:76/365 - (20%)
Similarity:135/365 - (36%) Gaps:98/365 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 DKTVAPLNEMIQRLKQKQNFGEDEVTIIVTGLPQTSETVKKATRKL--------VQAYMQRYNLQ 158
            ||...|||  |..: ||.|     |.::       ||.:.:..|..        |.:..|..|..
  Fly    31 DKATNPLN--IDSV-QKHN-----VKLL-------SEQLNRGWRAFCDAPVDEGVMSLFQGINPS 80

  Fly   159 QQRQHG------------KNGNQDYQDQSNEQRK-----NQRTSSEEDYSEE-----VKNAKTQS 201
            ..|.|.            |:.:|......|.:||     |...:::..:|.:     ::|:: :.
  Fly    81 DARLHVMTITNQSVELPIKSISQIKDFDINPERKTLIYVNAFHTADSYFSVQEHLTLLQNSR-RD 144

  Fly   202 GDIIVIDLGS-------------KLNTYERYAMLDIEKTGAKIGKWIVQMVNELDMPFDTIHLIG 253
            .::||:|...             .:|.|..|.:|              :.:.:..:....|.|.|
  Fly   145 LNVIVVDFAKDVAQLYYAVRHHLSVNGYFVYKLL--------------RALKDAGIAVQDITLAG 195

  Fly   254 QNVGAHVAGAAAQEFTRLTGHKLRRVTGLDPSK-------IVAKSKNTLTGLARGDAEFVDAIHT 311
            .:|||::|...||.|.:.....:.::..:||:.       :|.:|......:..|:.:       
  Fly   196 HSVGANIAALGAQLFAKENKQLVGQLLAIDPATMCRTTDILVKQSVALRVVVLHGEGD------- 253

  Fly   312 SVYGMGTPIRSGDVDFYPNG----PAAGV-PGASNVVEAAMRATRYFAESVRPGNERSFPAVPAN 371
             |:|:..|:  |.:|.||||    |...: ||..:.:.:.|.....|.|::..|  ...||....
  Fly   254 -VFGVRVPL--GHIDIYPNGIGYFPRRKLQPGCESKICSHMYPFILFMEALIEG--VMIPATKCE 313

  Fly   372 SLQQYKQND-GFGKRAYMGIDTAHDLEGDYILQVNPKSPF 410
            |..:::|.| .|.....:|:....:.:|.|.....|..||
  Fly   314 SWAKFRQGDCNFQNTINIGLIYPANAKGLYFCMTQPNPPF 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 49/253 (19%)
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 55/284 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438289
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007604
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.