DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and CG10357

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster


Alignment Length:254 Identity:75/254 - (29%)
Similarity:120/254 - (47%) Gaps:41/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 VKNAKTQSG--DIIVIDLGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELDMPFDTIHLIGQNV 256
            ::||.|..|  :::|.|.|...|.....:.|.::.....:.|.:.:.:....:..:.:|:||.::
  Fly    74 LRNAYTAQGYENVLVADWGPVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSL 138

  Fly   257 GAHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSVYGMGTPIR 321
            |||:||...:.|....|    |||||||:..:..|::. ..|....|:|||.|||. |.:...||
  Fly   139 GAHIAGRIGRYFNGSLG----RVTGLDPALPLFSSRSD-DSLHSNAAQFVDVIHTD-YPLFGDIR 197

  Fly   322 -SGDVDFYPNGPAAGVPGASNV-VEAAM------------RATRYFAESVRPGNERSFPAVPAN- 371
             .|.||||||...|..||..|| |.||.            ||..::|||:  |...:||||..: 
  Fly   198 PRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESI--GMPENFPAVSCSL 260

  Fly   372 -SLQQYKQNDGFGKRAYMGIDTAHDLE----GD---------YILQVNPKSPF--GRNA 414
             :::..:..|...:::....:.|:|.:    |:         |.|:.|...|:  |||:
  Fly   261 TAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRSATLYYYLETNGAPPYGQGRNS 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 70/242 (29%)
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.