DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and CG13562

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:208 Identity:42/208 - (20%)
Similarity:75/208 - (36%) Gaps:55/208 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 RYNLQQQRQHGKNGNQDYQDQSNEQR---KNQRTSSEEDYSEEVKNAKTQSGDIIVIDLGSKLNT 215
            :|.:.:|:|..|....|  ..:::||   ..|:|.....|....|..:|.:.|......||..:.
  Fly    29 KYAILRQKQAAKATQND--TLAHQQRIKYDAQKTMKVMFYKNNTKTMETSAYDDAYDLSGSGCSP 91

  Fly   216 YERYAMLDIEKTGAKIGKWIVQMVNELDMPFDTIHLIGQNVGAHVAGAAAQEFTRLTGHKLRRVT 280
            .:::|::        :..||....:|.                     |.....||:.::...|.
  Fly    92 TDKFAIV--------LHGWIQSCSDEW---------------------ALSLIERLSYYRGGCVI 127

  Fly   281 GLDPSKIVAKSK--------NTLTGLARGDAEFVDAIHTSVYGMG-TPIRSGDVDFYPNGPAAGV 336
            .:|.| :||.|.        :||||.       :.:|..:::..| .|.|.....|...|..|..
  Fly   128 CIDYS-VVASSSYMRLYTNFDTLTGA-------ISSIILTLFRQGFDPKRGYMFGFSFGGQLASA 184

  Fly   337 PGAS----NVVEA 345
            .|.|    :::|:
  Fly   185 VGRSLRPHHIIES 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 34/176 (19%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 33/171 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.