DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and CG6472

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:259 Identity:81/259 - (31%)
Similarity:128/259 - (49%) Gaps:33/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 NQRTSSEEDYSEEVKNAKTQSG--DIIVIDLGSKLNTYERY--AMLDIEKTGAKIGKWIVQMVNE 241
            ::..:.|...|:|:|:|..:.|  ::|:|| .|.:.....|  |:.::..:|..:.:::..:|::
  Fly    87 SESATGERQSSQELKDAFLRRGNYNVILID-WSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDK 150

  Fly   242 LDMPFDTIHLIGQNVGAHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLARGDAEFV 306
             ..|...|||||.::||.|||.|.::... .|.||.|:|.|||:..:.:..::...|:..||.||
  Fly   151 -GYPAKYIHLIGFSLGAEVAGFAGKQLQE-WGIKLPRITALDPALPLFEGNSSNRRLSPSDARFV 213

  Fly   307 DAIHTSVYGMGTPIRSGDVDFYPNGPAAGVPGAS--NVVE---------AAMRATRYFAESVRPG 360
            |.|||....:|.|...|..||||||.....||.:  |:..         :..||..||.||:  .
  Fly   214 DVIHTDGGLLGNPAPMGHADFYPNGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESI--A 276

  Fly   361 NERSFPAVPANSLQQYKQNDGF-------GKRAYMGIDTAHDLEGDYILQVNPKSPFGRNAPAQ 417
            ..|.|||      |:.:.:|.|       |..|:||:.....:.|.:.|..|...|||||:.|:
  Fly   277 QPRGFPA------QRCEPSDMFGICREPGGGPAFMGMGADPRIRGKFYLDTNDAKPFGRNSRAR 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 74/244 (30%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445990
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.