DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and CG13282

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster


Alignment Length:263 Identity:68/263 - (25%)
Similarity:94/263 - (35%) Gaps:73/263 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 GKWIVQMVNELDMPFDT-IHLIGQNVGAHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTL 295
            |....|:|..|....:| ||:||.::||.|....|:   .|:...|.|:|||||:..:..:....
  Fly   171 GTCTAQLVERLVETGNTDIHVIGFSLGAQVPNYIAR---NLSSFMLPRITGLDPAMPLFITSGKA 232

  Fly   296 TGLARGDAEFVDAIHTSVYGMGTPIRSGDVDFYPNG----PAAGVPGASNVVEAAMRATRYFAES 356
            ..|...||.:||.|||:....|...|.|..|||.||    |.......::...:..||..||.||
  Fly   233 DKLDPSDASYVDVIHTNALVQGKMERCGHADFYMNGGIMQPGCNGQKINSFACSHQRAPAYFLES 297

  Fly   357 VRPGNERSF--------------PAVPANSLQQYKQNDGFGKRAYMGIDTAHDLEGDYILQVNPK 407
            :|  :.:.|              ...|.|.|.:..:|.....|....|||            |..
  Fly   298 IR--SPKGFWGWACSGYISYLLGMCPPTNFLLEAGENIRPTTRGMFMIDT------------NDS 348

  Fly   408 SPF--GR--------------NAPAQKQSS---------YHGVH------------QAWNTNQDS 435
            |||  |:              ..|.||..:         .|.:.            |.|.|.||.
  Fly   349 SPFALGKWTDLPTLGAKQPQWRVPTQKLKAPPNQGVDPLLHHIDQFGKLAANFNNLQMWPTEQDP 413

  Fly   436 KDY 438
            .::
  Fly   414 YEH 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 54/192 (28%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 56/196 (29%)
Pancreat_lipase_like 75..347 CDD:238363 54/192 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438323
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.