DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and CG14034

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:280 Identity:76/280 - (27%)
Similarity:110/280 - (39%) Gaps:73/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 HGKNGNQDY------------QDQSNEQRKNQRTSSEEDYSEEVKNAKTQSGDIIVIDLGSKLNT 215
            ||.||::|:            ||.:.......:.:.|..|:|.|.|||                 
  Fly    74 HGFNGHRDFSPNTQLRPLFLTQDYNLISLDYPKLAYEPCYTEAVHNAK----------------- 121

  Fly   216 YERYAMLDIEKTGAKIGKWIVQMVNELDM-PFDTIHLIGQNVGAHVAGAAAQEFTRLTGHKLRRV 279
               |.        |:....:::::.|..: ..:.:||||..:||||||...|   .|..|||..:
  Fly   122 ---YV--------ARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQ---FLPEHKLEHI 172

  Fly   280 TGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSVYGMGTPIRSGDVDFYPN-GPAAGVPGASNVV 343
            |.|||:|.....|:....|...||:|||.:||.|..:|.....|.||||.| |.:....|..|.:
  Fly   173 TALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNMGVSQPNCGPINKM 237

  Fly   344 EAAM----RATRYFAESV-RPG--------NERSFP---AVPANSLQQYKQNDGFGKRAYMGIDT 392
            |...    ||..|:|||: .|.        |.:||.   .:|..:::            .||...
  Fly   238 ETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICIPDKNIE------------LMGFHV 290

  Fly   393 AHDLEGDYILQVNPKSPFGR 412
            .....|.|.|..|...|:.:
  Fly   291 DPKARGRYFLDTNNGPPYAK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 67/240 (28%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 74/271 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.