DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and CG4267

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster


Alignment Length:258 Identity:63/258 - (24%)
Similarity:108/258 - (41%) Gaps:67/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 KNGNQDYQDQSNEQRKNQRTSSEEDYSEEVKNA---KTQSG-----------DIIVIDLGSKLNT 215
            :|...|.:.|:........:.|:..:..:||||   .|..|           ::||.| .||.:|
  Fly    97 RNSGFDARHQTRIVIHGWMSQSKGSHIRKVKNAYLSLTDPGPNGEPAPYEDFNVIVCD-WSKTST 160

  Fly   216 YERYAMLDIEKTGAKIGKWIVQMV----NELDMPFDTIHLIGQNVGAHVAGAAAQEFTRLTGHKL 276
            ...|  .::.||...:|..:.::|    .|.:|.:|.:::||.::||.:||:|.::   :..::.
  Fly   161 NVNY--YEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIGHSLGAQIAGSAGKQ---IMPYRF 220

  Fly   277 RRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSV-YGMGTPIRSGDVDFYP----NGPAAGV 336
            ..:..|||:....:.|:....:...||.:|::|.||| :|...|:  |...|||    |.....|
  Fly   221 NTIYALDPAGPQFREKSDEYRIDASDASYVESIQTSVSFGFEQPV--GHATFYPNYGKNQKKCYV 283

  Fly   337 PGASNVVEAAMRATRYFAESV----------------------------RPGNERSFPAVPAN 371
            .|.|:     .|:..||.||:                            |.|.|   |::|.|
  Fly   284 YGCSH-----KRSHDYFIESLTSPAGFWGPRCERHDDGTWLLLMSDGEFRMGGE---PSIPKN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 60/240 (25%)
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 63/258 (24%)
Pancreat_lipase_like 71..347 CDD:238363 63/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445896
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.