DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and pla1a

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_996939.1 Gene:pla1a / 334017 ZFINID:ZDB-GENE-030131-5949 Length:456 Species:Danio rerio


Alignment Length:216 Identity:58/216 - (26%)
Similarity:92/216 - (42%) Gaps:51/216 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YMQRYNLQQQ-----RQHGKNGNQDYQDQSNEQRKN-----------------QRTSSEEDYSEE 193
            |.|...||.|     |::....:...||..|..:|:                 :...|:..:...
Zfish    42 YRQATKLQVQYLLLTRKNANCASLFTQDCLNHTQKHTAYFNSSLPTKVIVHGYRALGSKPSWVSG 106

  Fly   194 VKNAKTQSGD--IIVID--LGSKLN---TYERYAMLDIEKTGAKIGKWIVQMVNEL---DMPFDT 248
            :..|..:..|  ::|:|  .|:...   ..|.|..:.::         |..::|:|   ....::
Zfish   107 LAQALLREEDVNVLVVDWVYGASFAYNLVVENYKEVAVQ---------ISVLINQLTKYGSTLES 162

  Fly   249 IHLIGQNVGAHVAGAAAQEFTRLTGH-KLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHT- 311
            .|.||.::||||:|.....|     | ||.|:|||||:..:.||.:....|...||.||:|||| 
Zfish   163 FHFIGVSLGAHVSGFVGTLF-----HGKLGRITGLDPAGPMFKSADPFDRLDSSDALFVEAIHTD 222

  Fly   312 -SVYGMGTPIRSGDVDFYPNG 331
             ..:|:..|:  |.|||:.||
Zfish   223 SDYFGISIPV--GHVDFFLNG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 48/162 (30%)
pla1aNP_996939.1 Lipase 21..340 CDD:278576 58/216 (27%)
Pancreat_lipase_like 48..336 CDD:238363 56/210 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.