DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and CG5966

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster


Alignment Length:272 Identity:68/272 - (25%)
Similarity:114/272 - (41%) Gaps:54/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 IIVIDLGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELDMP-FDTIHLIGQNVGAHVAGAAAQE 267
            :::||.|...:.....|:.:|...||.....:..:..||.:| .|.:|:||.::|||::|.|...
  Fly   147 VVLIDWGGGASPPYVQAVANIRLVGAITAHVVHMLYEELRLPNLDNVHIIGHSLGAHLSGYAGYH 211

  Fly   268 FTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSVY-----GMGTPIRSGDVDF 327
            .....|.|..|:|||||:..:....:.:..|.:.||.|||.:||...     |:|..:|.|.|||
  Fly   212 LQHDFGLKPARITGLDPAAPLFTDTDPIVRLDKTDAHFVDIVHTDANPLMKGGLGINMRLGHVDF 276

  Fly   328 YPNGPAAGVPGAS----NVVEAA--------------MRATRYFAESVRPGNERSFPAVPANSLQ 374
            :||| ....||.:    :||:..              :|:.:||.||:  |::..|..:..:|.:
  Fly   277 FPNG-GFDNPGCNKKFQDVVKKKTLFLTMQEFLGCNHIRSQQYFTESI--GSQCPFLGITCDSFE 338

  Fly   375 QYK--------------------QNDGFGKRAYMGIDTAHDLEGDYILQVNPKSPFGR------- 412
            .:|                    ..:.:.::..:|.....|..|.:.|......||.|       
  Fly   339 SFKDTKCTSCEEPGHTCLRMGYHSQEDYQEQVDLGQLQQGDSPGVFYLWTGDSKPFCRLHYRITV 403

  Fly   413 NAPAQKQSSYHG 424
            ......:|:.||
  Fly   404 RVSGHDESTLHG 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 62/245 (25%)
CG5966NP_572286.1 Lipase 46..394 CDD:278576 62/249 (25%)
Pancreat_lipase_like 76..390 CDD:238363 62/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.