DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and Lipi

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001099369.1 Gene:Lipi / 288322 RGDID:1310162 Length:476 Species:Rattus norvegicus


Alignment Length:193 Identity:57/193 - (29%)
Similarity:83/193 - (43%) Gaps:25/193 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 KTQSGDIIVIDLGSKLNT--YERYAMLDIEKTGAKIGKWIVQMVNEL---DMPFDTIHLIGQNVG 257
            |.:..::||:|......|  |.|..     |...|:.:.:.:.:..|   ....|..|.||.::|
  Rat   118 KQEDVNLIVVDWNQGATTFIYGRAV-----KNTRKVAEILREYIENLLIHGASLDNFHFIGMSLG 177

  Fly   258 AHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSVYGMGTPIRS 322
            ||:.|...:.|.    .:|.|:|||||:......|.:...|...||:|||.||:...|.|....|
  Rat   178 AHICGFVGKLFQ----GQLGRITGLDPAGPKFSGKPSNCRLDYTDAKFVDVIHSDSQGFGILEPS 238

  Fly   323 GDVDFYPNGPAAGVPGASNVVEAAM--------RATRYFAESVRPGNERSFPAVPANSLQQYK 377
            |.:|||||| ....||....:.:.|        ||...|.|:..  ...:|.:.|..|.:.||
  Rat   239 GHIDFYPNG-GRNQPGCPTSLLSGMDYIKCDHQRAVHLFLEAFE--TNCNFVSFPCRSYRDYK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 57/193 (30%)
LipiNP_001099369.1 Pancreat_lipase_like 57..346 CDD:238363 57/193 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338917
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.