DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and Pnlip

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_037293.2 Gene:Pnlip / 25702 RGDID:3360 Length:465 Species:Rattus norvegicus


Alignment Length:341 Identity:91/341 - (26%)
Similarity:143/341 - (41%) Gaps:80/341 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 NGNQD-YQ----DQSNEQRKNQRTS-------------SEEDY-SEEVKNA-KTQSGDIIVID-L 209
            |.||| ||    |.|:.:..|.:|:             .||:: |:..||. |.:|.:.|.:| .
  Rat    60 NENQDNYQKITSDASSIRNSNFKTNRKTRIIIHGFIDKGEENWLSDMCKNMFKVESVNCICVDWK 124

  Fly   210 GSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELDMPFDTIHLIGQNVGAHVAGAAAQEFTRLTGH 274
            |....||.: |..::...||::...:..:.::|....|.:||||.::|:||||.|.:.    |..
  Rat   125 GGSRATYTQ-ATQNVRVVGAEVALLVNVLKSDLGYSPDNVHLIGHSLGSHVAGEAGKR----TFG 184

  Fly   275 KLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSV--------YGMGTPIRSGDVDFYPNG 331
            .:.|:||||.::...:.......|...||:|||||||..        :||...:  |.:||:|||
  Rat   185 AIGRITGLDAAEPYFQGTPEEVRLDPTDAQFVDAIHTDAAPIIPNLGFGMSQTV--GHLDFFPNG 247

  Fly   332 PAAGVPGA-----SNVVE-----------AA---MRATRYFAESVRPGNERSFPAVPANSLQQYK 377
             ...:||.     |.:|:           ||   :|:.:|:.:|:  .|...|.....:|...:.
  Rat   248 -GMEMPGCQKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSI--VNPTGFSGFSCSSYNVFS 309

  Fly   378 QNDGF----------GKRA--YMGIDTAHDLEGDYILQVNPKSPFGR-------NAPAQKQSSYH 423
            .|..|          |..|  |.|  ...:|...:.|....||.|.|       ....||.:. |
  Rat   310 ANKCFPCGSEGCPQMGHYADKYPG--KTKELYQKFYLNTGDKSNFARWRYQVTVTLSGQKVTG-H 371

  Fly   424 GVHQAWNTNQDSKDYQ 439
            .:...:....:||.|:
  Rat   372 ILVSLFGNGGNSKQYE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 72/277 (26%)
PnlipNP_037293.2 Lipase 17..352 CDD:395099 83/303 (27%)
PLAT_PL 355..465 CDD:238857 6/34 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338906
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.