DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_061362.1 Gene:Pnliprp1 / 18946 MGIID:97723 Length:473 Species:Mus musculus


Alignment Length:281 Identity:73/281 - (25%)
Similarity:115/281 - (40%) Gaps:72/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PQTSET----VKKATRKLVQAYMQRYNLQQQRQHGKNGNQDYQDQSNEQRKNQRTSSEEDYSEEV 194
            |.|.|.    |.:.||.::..::.:                               .||::..::
Mouse    75 PSTIEASNFQVARKTRFIIHGFIDK-------------------------------GEENWVVDM 108

  Fly   195 -KNA-KTQSGDIIVID--LGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELDMPFDTIHLIGQN 255
             ||. :.:..:.|.:|  .||: .||.: |..::...||::.:.|..:|...:.....:||||.:
Mouse   109 CKNMFQVEEVNCICVDWKRGSQ-TTYTQ-AANNVRVVGAQVAQMIDILVRNFNYSASKVHLIGHS 171

  Fly   256 VGAHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSV------Y 314
            :||||||.|.   :|..|  |.|:|||||.:...:.......|...||:|||.|||..      .
Mouse   172 LGAHVAGEAG---SRTPG--LGRITGLDPVEANFEGTPEEVRLDPSDADFVDVIHTDAAPLIPFL 231

  Fly   315 GMGTPIRSGDVDFYPNG----PAAGVPGASNVVEA--------------AMRATRYFAESVRPGN 361
            |.||....|..||:|||    |.......|.:|:.              .:|:.:|:.||:.  |
Mouse   232 GFGTNQMVGHFDFFPNGGQYMPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYKYYLESIL--N 294

  Fly   362 ERSFPAVPANSLQQYKQNDGF 382
            ...|.|.|..|.:.::.|..|
Mouse   295 PDGFAAYPCASYRDFESNKCF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 67/228 (29%)
Pnliprp1NP_061362.1 Lipase 18..353 CDD:278576 73/281 (26%)
Pancreat_lipase_like 52..349 CDD:238363 73/281 (26%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835293
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.