DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and Lipc

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_006510879.1 Gene:Lipc / 15450 MGIID:96216 Length:526 Species:Mus musculus


Alignment Length:344 Identity:85/344 - (24%)
Similarity:139/344 - (40%) Gaps:78/344 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 GLPQTSETVKKATRK--LVQAYMQRYNLQQQRQH-------GKNGNQD----YQDQSNEQRKNQR 183
            |..:.|:.:||...:  |.|....|...:.:.||       |.|.:|.    ....|..:.....
Mouse    36 GATEASKPLKKPETRFLLFQDENDRLGCRLRPQHPETLQECGFNSSQPLIMIIHGWSGSESATVG 100

  Fly   184 TSSEEDYSEE-------------VKNAKTQSGDIIVIDLGSKLNTYERY--AMLDIEKTGAKIGK 233
            ..|:.||..:             :|:.::|..::.::|..|.  .|:.|  |:.:....|..:..
Mouse   101 KDSDSDYQVDGLLENWIWKIVSALKSRQSQPVNVGLVDWISL--AYQHYTIAVQNTRIVGQDVAA 163

  Fly   234 WIVQMVNELDMPFDTIHLIGQNVGAHVAGAAAQEFTRLTG-HKLRRVTGLDPSKIVAKSKNTLTG 297
            .::.:..........:||||.::||||:|.|.   :.:.| :|:.|:|||||:..:.:..:....
Mouse   164 LLLWLEESAKFSRSKVHLIGYSLGAHVSGFAG---SSMDGKNKIGRITGLDPAGPMFEGTSPNER 225

  Fly   298 LARGDAEFVDAIHT--------SVYGMGTPIRSGDVDFYPNGPAAGVPGA------SNVVEAAMR 348
            |:..||.|||||||        || |:..||  ...|||||| .:..||.      .::.|..:.
Mouse   226 LSPDDANFVDAIHTFTREHMGLSV-GIKQPI--AHYDFYPNG-GSFQPGCHFLELYKHIAEHGLN 286

  Fly   349 ATRYFAESVRPGNERSFPAVPANSLQQYK-QNDGF------------------GKRAYMGIDTAH 394
            |   ..::::..:|||.... .:|||... |:.||                  |:...:|.|...
Mouse   287 A---ITQTIKCAHERSVHLF-IDSLQHSDLQSIGFQCSDMGSFSQGLCLSCKKGRCNTLGYDIRK 347

  Fly   395 DLEGD---YILQVNPKSPF 410
            |..|.   ..|....:|||
Mouse   348 DRSGKSKRLFLITRAQSPF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 69/274 (25%)
LipcXP_006510879.1 Lipase 18..366 CDD:333880 83/342 (24%)
PLAT_LPL 369..504 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.