DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:373 Identity:87/373 - (23%)
Similarity:142/373 - (38%) Gaps:112/373 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PNYVPSGIQVY-VPKPNGDKTVAPLNEMIQRLKQKQNFGEDEVTIIVTGLPQTSETVKKATRKLV 148
            |..:.:...:| :..||..:.::.:|   ....|...||.|::|                     
Human    49 PEKINTRFLLYTIHNPNAYQEISAVN---SSTIQASYFGTDKIT--------------------- 89

  Fly   149 QAYMQRYNLQQQRQHGKNGNQDYQDQSNEQRKNQRTSSEEDYSEEVKNAKTQSGDIIVIDLGSKL 213
                 |.|:...:..||                        :..::.|...|..||..|:| ..:
Human    90 -----RINIAGWKTDGK------------------------WQRDMCNVLLQLEDINCINL-DWI 124

  Fly   214 NTYERY--AMLDIEKTGAKIGKWIVQMVNELDMPFDTIHLIGQNVGAHVAGAAAQEFTRLTGHKL 276
            |....|  |:.::...||::..:|..::.:.:.....:||||.::|||:||.|.   :|:.|  |
Human   125 NGSREYIHAVNNLRVVGAEVAYFIDVLMKKFEYSPSKVHLIGHSLGAHLAGEAG---SRIPG--L 184

  Fly   277 RRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSV------YGMGTPIRSGDVDFYPNGPAAG 335
            .|:|||||:.....:......|...||.|||.|||:.      .|:||....|.:|||||| ...
Human   185 GRITGLDPAGPFFHNTPKEVRLDPSDANFVDVIHTNAARILFELGVGTIDACGHLDFYPNG-GKH 248

  Fly   336 VPGASNVVEAAM--------------------RATRYFAESVRPGNERSFPAVPANSLQQYK--- 377
            :||..:::...:                    |:.:::|||:.  |..:|.|.|..|...:|   
Human   249 MPGCEDLITPLLKFNFNAYKKEMASFFDCNHARSYQFYAESIL--NPDAFIAYPCRSYTSFKAGN 311

  Fly   378 ----QNDG------FGKRAY---MGIDTAHDLEGDYILQVNPKSPFGR 412
                ..:|      |..|.:   |..:.:|     |.|.....|||.|
Human   312 CFFCSKEGCPTMGHFADRFHFKNMKTNGSH-----YFLNTGSLSPFAR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 69/266 (26%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 84/369 (23%)
Pancreat_lipase_like 52..348 CDD:238363 82/362 (23%)
PLAT_PL 355..467 CDD:238857 87/373 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145192
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.