DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp1 and pnliprp3

DIOPT Version :9

Sequence 1:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_031761690.1 Gene:pnliprp3 / 100487975 XenbaseID:XB-GENE-6250474 Length:420 Species:Xenopus tropicalis


Alignment Length:318 Identity:80/318 - (25%)
Similarity:134/318 - (42%) Gaps:69/318 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 QAYMQRYNLQQQRQHGKNGNQDYQDQ--------SNEQRKNQRT---------SSEEDYSEEVKN 196
            :|...||.|..:.      |.||..:        ::..:.|::|         ::|..:..|:..
 Frog     4 EAINTRYFLVTRE------NPDYFQEIISHSSVSTSNFKPNRKTRFIIHGFVNTAERGWQMEMCQ 62

  Fly   197 AKTQSGDI--IVID-LGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELDMPFDTIHLIGQNVGA 258
            ...:..|:  ..|| .|.....|.: |..:|...||::..:|..:....|.....||:||.::||
 Frog    63 VMLEVEDVNCFCIDWRGGSFTLYTQ-AANNIRVVGAELASFIGYLSKNYDYSPSMIHIIGHSLGA 126

  Fly   259 HVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSV------YGMG 317
            ||||.|.:   |:.|  :.|::||||:..:.::......|...||:|||||||..      .|:|
 Frog   127 HVAGEAGK---RVPG--IARISGLDPAGPLFQNTPPEVRLDPTDADFVDAIHTDTSPLIPKIGLG 186

  Fly   318 TPIRSGDVDFYPNGPAAGVPG-ASNVVEAA------------------MRATRYFAESVRPGNER 363
            .....|.:||:||| ...:|| .||::...                  :|:.:|:.||:|..:  
 Frog   187 MAQSVGHLDFFPNG-GQTMPGCGSNIITRLLDIEELWGGADNYLACNHLRSYKYYTESIRTPD-- 248

  Fly   364 SFPAVPANSLQQYKQNDGFGKRA--------YMGIDTAHDLEG-DYILQVNPKSPFGR 412
            :|.|.|:::.:.:.:..||...:        |.|......|.| ...|.....||:.|
 Frog   249 AFVAFPSDTYEAFMKGTGFPCPSTGCPLMGYYAGFYGRGTLSGLPLYLNTGDVSPYAR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 69/268 (26%)
pnliprp3XP_031761690.1 Lipase 2..304 CDD:395099 78/314 (25%)
PLAT 307..417 CDD:412108 80/318 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.