DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and Pla1a

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_598863.3 Gene:Pla1a / 85031 MGIID:1934677 Length:456 Species:Mus musculus


Alignment Length:174 Identity:55/174 - (31%)
Similarity:81/174 - (46%) Gaps:34/174 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 ATLNIERLGEIIG---NRLVELTNTVNVPQEIIHLIGSGPAAHVAGVAGRQFTRQTGHKLRRITA 282
            |..|:.:|...|.   ::|:||    .|.:..||:||....|||.|:.|..:..|.|    :||.
Mouse   132 AVENVVKLSLEISRFLSKLLEL----GVSESSIHIIGVSLGAHVGGMVGHFYKGQLG----QITG 188

  Fly   283 LDP-----TKIYGKPEERLTGLARGDADFVDAIHTSAYGMGTSQRLANVDFFPNG--PSTGVP-- 338
            |||     |:  ...||||..   |||.||:||||....:|....:.:||:|.||  ...|.|  
Mouse   189 LDPAGPEYTR--ASLEERLDA---GDALFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPAF 248

  Fly   339 ---GADNVVEATMRATRYFAESVRPGNERNFPSVA--ASSYQEY 377
               |.:.::...|||...:..::    |...|.:|  .:||:.:
Mouse   249 FHAGYNYLICDHMRAVHLYISAL----ENTCPLMAFPCASYKAF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 55/174 (32%)
Abhydrolase <221..407 CDD:304388 55/174 (32%)
Pla1aNP_598863.3 Lipase 14..336 CDD:333880 55/174 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.