DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:188 Identity:63/188 - (33%)
Similarity:87/188 - (46%) Gaps:37/188 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 ATLNIERLGEIIGNRLVELTNTVNVPQEIIHLIGSGPAAHVAGVAGRQFTRQTGHKLRRITALDP 285
            |..|:..:|..:...:..|....:.....:||||....|||||.||   :|..|  |.|||.|||
  Rat   136 AANNVRVVGAQVAQMIDILVKNYSYSPSKVHLIGHSLGAHVAGEAG---SRTPG--LGRITGLDP 195

  Fly   286 TK--IYGKPEERLTGLARGDADFVDAIHTSA------YGMGTSQRLANVDFFPNGPSTGVPGA-- 340
            .:  ..|.|||  ..|...||||||.|||.|      .|.||:|...::|||||| ...:||.  
  Rat   196 VEANFEGTPEE--VRLDPSDADFVDVIHTDAAPLIPFLGFGTNQMSGHLDFFPNG-GQSMPGCKK 257

  Fly   341 ---------DNVVEAT--------MRATRYFAESVRPGNERNFPSVAASSYQEYKQNK 381
                     |.:...|        :|:.:|:.||:.  |...|.:...:||::::.||
  Rat   258 NALSQIVDIDGIWSGTRDFVACNHLRSYKYYLESIL--NPDGFAAYPCASYKDFESNK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 63/188 (34%)
Abhydrolase <221..407 CDD:304388 63/188 (34%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 63/188 (34%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338896
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.