DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and CG34447

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster


Alignment Length:205 Identity:66/205 - (32%)
Similarity:93/205 - (45%) Gaps:45/205 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 LGEIIGNRLVELTNTVNVPQEIIHLIGSGPAAHVAGVAGRQFTRQTGHKLRRITALDPTK---IY 289
            |.::|.|    |.:...|..:.|||||......|||    |.......|::|||.|||.|   |.
  Fly   133 LAQLINN----LVDRAIVANDQIHLIGFSLGGQVAG----QTANYVKRKMKRITGLDPAKPLFIL 189

  Fly   290 GKPEERLTGLARGDADFVDAIHTSAYGMGTSQRLANVDFFPN-GPSTGVPGA--DNVVEATM--- 348
            |....||.   :|||||||.|||..:|.|..:...:|||:|| |...  ||.  :|:.:.:.   
  Fly   190 GPDSRRLD---KGDADFVDVIHTDVFGRGYLRAAGHVDFYPNFGAKQ--PGCMEENMQDPSSCNH 249

  Fly   349 -RATRYFAESVRPGNERNFPSVAASSYQEYKQNKGY-----------GKRGYMGIATDFDLQGDY 401
             ||.|::|||:         :.....:.  :|..|:           |.:..:|.....:|:|.|
  Fly   250 ERAPRFYAESI---------NTTVGFWA--RQCSGWLLQLLTLCPTTGAQALLGYHVSDELRGSY 303

  Fly   402 ILQVNSKSPF 411
            .||..||||:
  Fly   304 FLQTASKSPY 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 65/203 (32%)
Abhydrolase <221..407 CDD:304388 62/199 (31%)
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 62/199 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438314
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.