DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and CG17191

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster


Alignment Length:422 Identity:92/422 - (21%)
Similarity:161/422 - (38%) Gaps:99/422 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRTLCVMACLLAVAMGNPQSGNRSGRRSNSLDNVEQPSNWVNPREVEELPNLKEVTLKKLQEMSL 68
            :|....:|.|||.....|.....:|.....:..::....|::.::.|||.|              
  Fly     1 MRVFIALAALLATVSALPIEERVNGENGWYVPQIDGSFEWMDKQDAEELLN-------------- 51

  Fly    69 EEGATLLDKLYHLSQFNHVFKPDYTPEPSQIRGYIVGERGQKIEFNLNTLVEKVKRQQKFGDDEV 133
                                           |..::..|...:.|.|.|     |.....| .|:
  Fly    52 -------------------------------RNSLIETRSNDVSFYLYT-----KHNPTVG-KEI 79

  Fly   134 TIFIQGLPETNTQVQKATRKLVQAYQQRYNLQPYETTDYSNEEQSQRSSSEEQQTQRRKQNGEQD 198
            ......:.:::....:.||.::..:..||       ||..|.:.::...|:              
  Fly    80 RADASSIEDSHFDKNQGTRFVIHGWNGRY-------TDGMNVKITRAWLSK-------------- 123

  Fly   199 DTKTGD--LIVIQLGNAIEDFEQYATLN-IERLGEIIGNRLVELTNTVNVPQEIIHLIGSGPAAH 260
                ||  :||:....| :..:..:::. :...|..:|..:..|....::..|.:.:||....||
  Fly   124 ----GDYNVIVVNWDRA-QSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAH 183

  Fly   261 VAGVAGRQFTRQTGHKLRRITALDPTK---IYGKPEERLTGLARGDADFVDAIHTSAYGMGTSQR 322
            |||.||:|.   .|.::..|..|||..   .|.||::|   |:..||.:|::|.|:....|..:.
  Fly   184 VAGYAGKQV---GGKRVHTIVGLDPAMPLFAYDKPDKR---LSTEDAFYVESIQTNGGEKGFLKP 242

  Fly   323 LANVDFFPNGPSTGVPGADNVVEATM---RATRYFAESVRPGNERNFPSVAASSYQEYKQNK-GY 383
            :....|:||| ....||..:.:..|.   |:..|:.|:|   .|.||.::....||....|: |.
  Fly   243 IGKGTFYPNG-GRNQPGCGSDIGGTCAHGRSVTYYVEAV---TEDNFGTIKCHDYQAALANECGS 303

  Fly   384 GKRGY-MGIATD-FDLQGDYILQVNSKSPFGR 413
            ...|. ||..|: :.:.||:.:.||.::|||:
  Fly   304 TYSGVRMGAVTNAYMVDGDFYVPVNGQAPFGK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 77/325 (24%)
Abhydrolase <221..407 CDD:304388 55/195 (28%)
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 73/307 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445902
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.