DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and sxe2

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster


Alignment Length:231 Identity:67/231 - (29%)
Similarity:102/231 - (44%) Gaps:45/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 LTNTVNVPQEIIHLIGSGPAAHVAGVAGRQFTRQTGHKLRRITALDP---TKIYGKPEERLTGLA 300
            |.:...||.|.|::||....:|::|:.|:..   ..|:|..|.||||   |::...|||||.   
  Fly   172 LHDNTGVPYEQIYMIGHSAGSHISGLTGKLL---RPHRLGAIFALDPAGLTQLSLGPEERLD--- 230

  Fly   301 RGDADFVDAIHTSAYGMGT-SQRLANVDFFPNGPSTGVPGADNVVEAT--------MRATRYFAE 356
            ..||.:|::|||....:|. |.:|::..||.|. ..|.|...|.. ||        ..|..||||
  Fly   231 VNDALYVESIHTDLTLLGNPSTKLSHASFFANW-GLGQPHCPNAT-ATEFDFVCDHFAAMFYFAE 293

  Fly   357 SVRPGNERNFPSVAASS---------------YQEYKQNKGYGKRGYMGIATDFDLQGDYILQVN 406
            |||  ..::|.::..||               .::|..|...|.. :||.......:|.:.|...
  Fly   294 SVR--QPKSFAALRCSSAKSVLSATCNCNVGGSEKYAVNTCTGNE-FMGGEPAVPKRGIFYLSTR 355

  Fly   407 SKSPFGRSTPAQKQTGYHQVHQPWRQSSSNQGSRRQ 442
            .:||:|.|      .|...:.:| |.|:..:.:.|:
  Fly   356 PQSPYGTS------DGLVHIKRP-RPSTIRETANRR 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 59/198 (30%)
Abhydrolase <221..407 CDD:304388 58/194 (30%)
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 59/198 (30%)
Pancreat_lipase_like 72..356 CDD:238363 58/194 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445993
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.