DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and CG10116

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:220 Identity:63/220 - (28%)
Similarity:104/220 - (47%) Gaps:21/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 EQDDTKTGDLIVIQLGNAIEDFEQYATLNIERLGEIIGNRLVELTNTVNVPQEIIHLIGSGPAAH 260
            :|.|:   ::|.:.|..|.::.|         :.:.:.:.::.|.|..::|.:.|.::|....||
  Fly    81 QQQDS---NIISVDLSEANDETE---------IIDSVASLVIVLHNQFDMPLDRILVVGFAEGAH 133

  Fly   261 VAGVAGRQFTRQTGHKLRRITALDPTKIYGKPEERLTGLARGDADFVDAIHTSAYGMGTSQRLAN 325
            :||....:..:..|.:|.:||||||:    ...|....|::.||:||:.:||:|.|.||.:||.:
  Fly   134 LAGGVAAKVQQDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGH 194

  Fly   326 VDFFPNGPSTGVPGADNVVEATMRATRYFAESVRPGNERNFPSVAASSYQEYKQNKGYGKRGYMG 390
            ||::|||..| .||......:..||....||...|  |.:|.|....|.:....:........||
  Fly   195 VDYYPNGGQT-QPGCTTDSCSHERAFELLAEMWSP--ENDFVSARCGSVETLSASSCRWSTHKMG 256

  Fly   391 IATDFD--LQGDYILQVNSKSPFGR 413
            ...:.:  ..|.|.|:....|||.|
  Fly   257 QKQEEEQPASGIYFLETRQSSPFSR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 60/216 (28%)
Abhydrolase <221..407 CDD:304388 53/187 (28%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 59/211 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438318
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.