DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and CG6472

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:393 Identity:97/393 - (24%)
Similarity:150/393 - (38%) Gaps:99/393 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 MSLEEGATLLDKLYHLSQFNHVFKPDYTPEPSQIRG-----YIVGERGQKIEFNLNTLVEKVKRQ 125
            |.|...:||.:....|...:.:|   |:..|   ||     ..:.|| :.|:|.|.|...:...|
  Fly     1 MVLTAASTLCNVFTFLLAGSPIF---YSAAP---RGSCSTCCAIKER-EDIKFMLYTSRNRNSAQ 58

  Fly   126 QKFGDDE-------------VTIFIQGLPETNTQVQKATRKLVQAYQQRYNLQPYETTDYSNEEQ 177
            .....|:             :.|::.|..|:.|..::::::|..|:.:|.|.             
  Fly    59 LLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSSQELKDAFLRRGNY------------- 110

  Fly   178 SQRSSSEEQQTQRRKQNGEQDDTKTGDLIVIQ---------LGNAIEDFEQYATLNIERLGEIIG 233
                                      ::|:|.         ..||:|        |:...|..:.
  Fly   111 --------------------------NVILIDWSAMTAVPWYSNAVE--------NLPVSGRYLA 141

  Fly   234 NRLVELTNTVNVPQEIIHLIGSGPAAHVAGVAGRQFTRQTGHKLRRITALDPTKIYGKPEERLTG 298
             |.:........|.:.|||||....|.|||.||:|. ::.|.||.|||||||.....:.......
  Fly   142 -RFLRFLVDKGYPAKYIHLIGFSLGAEVAGFAGKQL-QEWGIKLPRITALDPALPLFEGNSSNRR 204

  Fly   299 LARGDADFVDAIHTSAYGMGTSQRLANVDFFPNGPSTGVPGA--DNVVE---------ATMRATR 352
            |:..||.|||.|||....:|....:.:.||:|||.....||.  .|:..         :..||..
  Fly   205 LSPSDARFVDVIHTDGGLLGNPAPMGHADFYPNGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWE 269

  Fly   353 YFAESVRPGNERNFPSVAASSYQEYK--QNKGYGKRGYMGIATDFDLQGDYILQVNSKSPFGRST 415
            ||.||:  ...|.||:........:.  :..| |...:||:..|..::|.:.|..|...||||::
  Fly   270 YFVESI--AQPRGFPAQRCEPSDMFGICREPG-GGPAFMGMGADPRIRGKFYLDTNDAKPFGRNS 331

  Fly   416 PAQ 418
            .|:
  Fly   332 RAR 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 84/353 (24%)
Abhydrolase <221..407 CDD:304388 60/198 (30%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 79/331 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.