DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and CG6675

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster


Alignment Length:450 Identity:97/450 - (21%)
Similarity:170/450 - (37%) Gaps:107/450 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRTLCVMACLLAVAMGNPQSGNRSGRRSNSLDNVE-QPSNWVNPREVEELPNLKEVT--LKKLQE 65
            :||.....||....:|.|::       :..:|:.: :...::|     .||||.:..  |.:..:
  Fly     1 MRTHLFALCLSMATIGIPKA-------NGVMDDYDAEMGEFMN-----ALPNLDDTPYGLGQRSD 53

  Fly    66 MSL--EEGATL--LDKLYHLSQFNHVFKPDYTPEPSQIRG--------YIVGERGQKIEFNLNTL 118
            :|.  ||...|  ||..|  .:..|........:.|:.||        :|     :||..|||..
  Fly    54 ISTEPEEDDILASLDDEY--EEAKHCVWNTCDKDLSESRGIGKFLDLPFI-----KKIASNLNPF 111

  Fly   119 VEKVKRQQKFGDDEVTIFIQGLPETNTQVQKA---------------TRKLVQAYQQRYNLQPYE 168
            ..|..|...:      :|.:..||...:|..:               ||.::..:.         
  Fly   112 GSKKLRMHFY------LFKREFPECGREVDFSIERKWRHCGFNASLPTRLMIHGWM--------- 161

  Fly   169 TTDYSNEEQSQRSSSEEQQTQRRKQNGEQDDTKTGDLIVIQLGNAIEDFEQYATLN-IERLGEII 232
                   .||:.|.:.:.:....|: ||.      ::||:....:..:...::.:. ||..|..:
  Fly   162 -------SQSRGSFNRDVKNAYLKK-GEY------NVIVVDWSASSANINYFSVVKLIETFGAEL 212

  Fly   233 GNRLVELTNTVNVPQEIIHLIGSGPAAHVAGVAGRQFTRQTGHKLRRITALDPTKIYGKPEERLT 297
            ...:..|........:.::|||....|.:||.||:   |....|:..|.||||    ..|:.|..
  Fly   213 AQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGK---RLKPVKVNTIFALDP----AGPKFRHR 270

  Fly   298 G----LARGDADFVDAIHTSAYGMGTSQRLANVDFFPN----GPSTGVPGADNVVEATMRATRYF 354
            |    :...||.:|:::|||| ..|..:...:..|:||    ..|....|..::     |:.:.|
  Fly   271 GTEFRIDPSDAKYVESMHTSA-NFGFRRPTGSATFYPNYGAYQHSCYYLGCSHI-----RSYQMF 329

  Fly   355 AESVR-PGNERNFPSVAASS-YQ-EYKQNKGYGKRGYMGIATDFDLQGDYILQVNSKSPF 411
            |||:. |......|.:..:. :| :|.|.:.....|...|    ..:|.:.::.:|..||
  Fly   330 AESINSPLGFWGTPCIRDNGRWQCDYSQRQSIQMAGEPSI----HKEGIFYVKTSSSDPF 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 74/348 (21%)
Abhydrolase <221..407 CDD:304388 48/197 (24%)
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 63/310 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.