DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and CG17292

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster


Alignment Length:234 Identity:72/234 - (30%)
Similarity:115/234 - (49%) Gaps:25/234 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 EQDDTKTGDLIVIQLGNAIED---FEQYATLNIERLGEIIGNRLVELTNTVNVPQEIIHLIGSGP 257
            |:.||   :|||:..|...:.   |:.:.  |:::||..:...|:::.:. .:..|..|::|...
  Fly    86 ERKDT---NLIVLDWGELADGNYMFDAFP--NLKQLGPELAKVLLKMFDH-GLDIEKFHIVGHSM 144

  Fly   258 AAHVAGVAGRQFTRQTG--HKLRRITALDPTKIYGKPEERLTGLARGDADFVDAIHTSAYGMGTS 320
            ...:||:.||:.|::|.  .|::||:||||......|.   |.|:..||:|||.|||.|:..|..
  Fly   145 GGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPG---THLSANDAEFVDVIHTDAWLYGAP 206

  Fly   321 QRLANVDFFPNGPSTGVPG---------ADNVVEATMRATRYFAESVRPGNERNFPSVAASSYQE 376
            ......||:|||..:..||         :||.:.:..|:..::||||.......|.:|.|..:.:
  Fly   207 TSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWWFWAESVSDRYPIGFDAVPAKKWSD 271

  Fly   377 YKQNKGYGK--RGYMGIATDFDLQGDYILQVNSKSPFGR 413
            :||||....  ...||......:.||:.||.|..:||.|
  Fly   272 FKQNKIVENCPPVVMGHHCPTTIHGDFYLQTNGHTPFAR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 69/230 (30%)
Abhydrolase <221..407 CDD:304388 60/198 (30%)
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 68/225 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.