DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and CG7367

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster


Alignment Length:328 Identity:77/328 - (23%)
Similarity:128/328 - (39%) Gaps:66/328 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 GDDEVTIFIQGLPETNTQVQKATRKLVQAYQQRYNLQPYETTDY----SNEEQSQRSSSEEQQTQ 189
            |..||...::..||....:.:..:      .:.|......:.|:    :|.|..||...:..|..
  Fly    73 GKPEVAYLVEPPPENRINLPQLIK------FELYGSDSSSSADFWIDENNFEFPQRHKRDTWQEM 131

  Fly   190 RRKQNGEQDDTKTGDLIVIQ------LGNAIED----FEQYATLNI------------------- 225
            ..|.|.|. |||    |::.      :.|:|:.    :.:...:|:                   
  Fly   132 AEKFNPEL-DTK----ILVHGWKSSTMSNSIQSIRGAYIERGQVNVFAINWKDQADNIYYLTPAR 191

  Fly   226 --ERLGEIIGNRLVELTNTVNVPQEIIHLIGSGPAAHVAGVAGRQFTRQTGHKLRRITALDPTK- 287
              .::|..:...:..|....:.....|||||....||:.|.||    ..|.:::.|||.|||.: 
  Fly   192 YTVQVGRAVAKLIDLLVEEKDADPNRIHLIGHSLGAHIMGYAG----SYTKYRVNRITGLDPARP 252

  Fly   288 ----IYGKPEERLTGLARGDADFVDAIHTSAYGMGTSQRLANVDFFPNGPSTGVPGADNVVE--- 345
                ..| ||..|...   ||:|||.||:.|..:|..:.:..|||:|||.....||...:.:   
  Fly   253 AFEDCIG-PENHLDDT---DANFVDVIHSCAGYLGFRKPIGMVDFYPNGGGPPQPGCKELSQIFT 313

  Fly   346 --ATMRATRYFAESVRPGNERNFPSVAASSYQEYKQNKGYGKRGYMGIATDFDLQGDYILQVNSK 408
              :..|:..|:|||:  .:.:.|..|..|...|.|.....|.:..||.....:.:|.:.::..:|
  Fly   314 GCSHGRSYEYYAESI--NSPKGFYGVPCSGLDELKGKNCTGGKILMGDPVPREARGIFFVKTANK 376

  Fly   409 SPF 411
            ..:
  Fly   377 PSY 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 77/326 (24%)
Abhydrolase <221..407 CDD:304388 55/216 (25%)
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 69/273 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438306
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.