DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and CG14034

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:246 Identity:76/246 - (30%)
Similarity:104/246 - (42%) Gaps:38/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 NGEQD---DTKTGDLIVIQLGNAIE-DFEQY--------ATLNIERLGEIIGNRLVELTNTVNVP 246
            ||.:|   :|:...|.:.|..|.|. |:.:.        |..|.:.:.......|..|..:..|.
  Fly    77 NGHRDFSPNTQLRPLFLTQDYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVK 141

  Fly   247 QEIIHLIGSGPAAHVAGVAGRQFTRQTGHKLRRITALDPTKIYGKPEERLTGLARGDADFVDAIH 311
            .|.:||||.|..|||||..| ||..:  |||..||||||.|.:...::....|...||.|||.:|
  Fly   142 IEDLHLIGLGLGAHVAGFIG-QFLPE--HKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVH 203

  Fly   312 TSAYGMGTSQRLANVDFFPN-GPSTGVPGADNVVEATM----RATRYFAESVRPGNERNFPSVAA 371
            |....:|....:.:|||:.| |.|....|..|.:|...    ||..|:|||:         |..:
  Fly   204 TDVTMLGLLDAVGHVDFYLNMGVSQPNCGPINKMETHFCYHNRAADYYAESI---------SSPS 259

  Fly   372 SSYQEYKQN-KGYGKR--------GYMGIATDFDLQGDYILQVNSKSPFGR 413
            ..|..|..| |.:.|.        ..||...|...:|.|.|..|:..|:.:
  Fly   260 GFYGFYCPNFKSFAKGICIPDKNIELMGFHVDPKARGRYFLDTNNGPPYAK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 75/242 (31%)
Abhydrolase <221..407 CDD:304388 65/199 (33%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 74/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.