DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and CG18641

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster


Alignment Length:390 Identity:88/390 - (22%)
Similarity:136/390 - (34%) Gaps:118/390 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KPDYTPEPSQIRGYIVGERGQKIEFNLNTLVEKVKRQQKFGDDEVTIFIQGLPETNTQVQKATRK 153
            ||...|.|             ||:|.|.|  .:.:.|.:|.|   .:....|..|:...:..|:.
  Fly    61 KPYRCPHP-------------KIQFYLYT--RRTQEQPEFID---VLDPNALYYTHFNPRHPTKI 107

  Fly   154 LVQAYQQRYNLQP--------YETTDYSNEEQSQRSSSEEQQTQRRKQNGEQDDTKTGDLIVIQL 210
            ::..:.....|.|        :...:|                               ::|::..
  Fly   108 IIHGFGGGRTLSPSPDLREAYFSVGEY-------------------------------NIIIVDY 141

  Fly   211 GNAIED--------FEQYATLNIERLGEIIGNRLVELTNTVNVPQEIIHLIGSGPAAHVAGVAGR 267
            .:|:::        ..::.:|.|.:|.:.:..      :...|..:.:|.||....||:||:...
  Fly   142 ADAVKEPCLSQMDWAPRFGSLCISQLVKYLAR------HPRGVQPDDLHFIGYSVGAHIAGLVAN 200

  Fly   268 QFTRQTGHKLRRITALDPTKIYGKPEERLTGLARGDADFVDAIHTSAYGMGTSQRLANVDFFPNG 332
            ....:.| ||.||||||||..:.........|...||.|||.:||.|..:|......:.||:.||
  Fly   201 YLKPEEG-KLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQWHSSGHADFYVNG 264

  Fly   333 PSTGVPGADNVVEATM---------RATRYFAESVRPGNERNF---PSVAASSY---------QE 376
             .|..|..  |..||:         :.|.||.||:.  ..|.|   |.....||         .|
  Fly   265 -GTRQPAC--VGSATLFQTLACDHTKVTPYFIESIT--TTRGFYAGPCPNLFSYLIGWCEPKDSE 324

  Fly   377 YKQNKGYGKRGYMGIATDFDLQGDYILQVNSKSPFGRSTPAQKQTGYHQVHQPWRQSSSNQGSRR 441
            |.         .||.......:|:|.:..|:|:||.|..|.:           .|.:...||.||
  Fly   325 YV---------LMGEHCSHKARGNYYVTTNAKAPFARGFPGK-----------GRSNGEYQGVRR 369

  Fly   442  441
              Fly   370  369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 75/350 (21%)
Abhydrolase <221..407 CDD:304388 57/206 (28%)
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 74/347 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.