DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and Lipi

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_011244435.1 Gene:Lipi / 320355 MGIID:2443868 Length:485 Species:Mus musculus


Alignment Length:204 Identity:62/204 - (30%)
Similarity:87/204 - (42%) Gaps:44/204 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 EQDDTKTGDLIVIQLGNAIEDFEQYATL--------NIERLGEI----IGNRLVELTNTVNVPQE 248
            :|:|.   :|||:       |:.|.||.        |..|:.||    |.|.|:...:..|    
Mouse   118 KQEDV---NLIVV-------DWNQGATTFMYSRAVRNTRRVAEILRETIENLLIHGASLDN---- 168

  Fly   249 IIHLIGSGPAAHVAGVAGRQFTRQTGHKLRRITALDPT--KIYGKPEERLTGLARGDADFVDAIH 311
             .|.||....||::|..|:.|..|.|    |||.|||.  :...||..  :.|...||.|||.||
Mouse   169 -FHFIGMSLGAHISGFVGKIFHGQLG----RITGLDPAGPQFSRKPSN--SRLYYTDAKFVDVIH 226

  Fly   312 TSAYGMGTSQRLANVDFFPNG-------PSTGVPGADNVVEATMRATRYFAESVRPGNERNFPSV 369
            |....:|..:...::||:|||       |::...|.:.:.....||...|..:..  ...||.|.
Mouse   227 TDIKSLGIGEPSGHIDFYPNGGKHQPGCPTSIFSGTNFIKCDHQRAIYLFLAAFE--TSCNFVSF 289

  Fly   370 AASSYQEYK 378
            ...||::||
Mouse   290 PCRSYKDYK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 62/204 (30%)
Abhydrolase <221..407 CDD:304388 55/179 (31%)
LipiXP_011244435.1 Pancreat_lipase_like 57..346 CDD:238363 62/204 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835316
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.