DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and Pnlip

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_037293.2 Gene:Pnlip / 25702 RGDID:3360 Length:465 Species:Rattus norvegicus


Alignment Length:345 Identity:95/345 - (27%)
Similarity:148/345 - (42%) Gaps:72/345 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IQGLPETNTQVQKATRKLVQAYQQRYNLQPYETTDYSNEEQSQRSSSEEQQ------TQRRKQNG 195
            ::.||.:..|:.  ||.|:...:.:.|.|.. |:|.|:...|...::.:.:      ..:.::|.
  Rat    41 LKALPWSPAQIN--TRFLLYTNENQDNYQKI-TSDASSIRNSNFKTNRKTRIIIHGFIDKGEENW 102

  Fly   196 EQDDTKTGDLIVIQLGNAI-EDFE-------QYATLNIERLGEIIGNRLVELTNTVNVPQEIIHL 252
            ..|..|  ::..::..|.| .|::       ..||.|:..:|..:...:..|.:.:....:.:||
  Rat   103 LSDMCK--NMFKVESVNCICVDWKGGSRATYTQATQNVRVVGAEVALLVNVLKSDLGYSPDNVHL 165

  Fly   253 IGSGPAAHVAGVAGRQFTRQTGHKLRRITALDPTKIY--GKPEERLTGLARGDADFVDAIHTSA- 314
            ||....:||||.||    ::|...:.|||.||..:.|  |.|||  ..|...||.|||||||.| 
  Rat   166 IGHSLGSHVAGEAG----KRTFGAIGRITGLDAAEPYFQGTPEE--VRLDPTDAQFVDAIHTDAA 224

  Fly   315 -----YGMGTSQRLANVDFFPNGPSTGVPGA-----------DNVVEAT--------MRATRYFA 355
                 .|.|.||.:.::|||||| ...:||.           |.:.|.|        :|:.:|:.
  Rat   225 PIIPNLGFGMSQTVGHLDFFPNG-GMEMPGCQKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYT 288

  Fly   356 ESVRPGNERNFPSVAASSYQEYKQNKGY--GKRG--YMGIATD------FDLQGDYILQVNSKSP 410
            :|:  .|...|...:.|||..:..||.:  |..|  .||...|      .:|...:.|....||.
  Rat   289 DSI--VNPTGFSGFSCSSYNVFSANKCFPCGSEGCPQMGHYADKYPGKTKELYQKFYLNTGDKSN 351

  Fly   411 FGR-------STPAQKQTGY 423
            |.|       :...||.||:
  Rat   352 FARWRYQVTVTLSGQKVTGH 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 89/324 (27%)
Abhydrolase <221..407 CDD:304388 69/222 (31%)
PnlipNP_037293.2 Lipase 17..352 CDD:395099 89/324 (27%)
PLAT_PL 355..465 CDD:238857 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.