DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and Liph

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001077363.1 Gene:Liph / 239759 MGIID:2388029 Length:451 Species:Mus musculus


Alignment Length:202 Identity:60/202 - (29%)
Similarity:87/202 - (43%) Gaps:41/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LIVIQLGN-AIEDFEQYATLNI------------ERLGEIIGNRLVELTNTVNVPQEIIHLIGSG 256
            ||.:|..| .:.|:.:.||..|            ..|.|.|...||:..:..|     |::||..
Mouse    95 LISVQEMNVVVVDWNRGATTVIYPHASSKTRQVASILKEFIDQMLVKGASLDN-----IYMIGVS 154

  Fly   257 PAAHVAGVAGRQFTRQTGHKLRRITALDPT--KIYGK-PEERLTGLARGDADFVDAIHTSAYGMG 318
            ..||:||..|..:.    .||.|:|.|||.  ...|: |||||.   ..||.|||.||:....:|
Mouse   155 LGAHIAGFVGESYE----GKLGRVTGLDPAGPLFNGRPPEERLD---PSDALFVDVIHSDTDALG 212

  Fly   319 TSQRLANVDFFPNGPSTGVPGADNVV---------EATMRATRYFAESVRPGNERNFPSVAASSY 374
            ..:.|.::||:||| ....||....:         :..|....|.| |::  |..:..:....||
Mouse   213 YKEALGHIDFYPNG-GLDQPGCPKTIFGGIKYFKCDHQMSVYLYLA-SLQ--NNCSITAYPCDSY 273

  Fly   375 QEYKQNK 381
            ::|:..|
Mouse   274 RDYRNGK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 60/202 (30%)
Abhydrolase <221..407 CDD:304388 55/185 (30%)
LiphNP_001077363.1 Pancreat_lipase_like 41..310 CDD:238363 60/202 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.