DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp2 and LOC100331214

DIOPT Version :9

Sequence 1:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:361 Identity:91/361 - (25%)
Similarity:128/361 - (35%) Gaps:125/361 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SLEEGATLLDKLYHLSQFNHVFKPDYTPEPSQIRGYIVGERGQKIEFNLNTLVEKVKRQQKFG-- 129
            :||||..|          |.||  |:..|                  :|..|.:..|...||.  
Zfish    24 ALEEGNVL----------NGVF--DHFLE------------------DLRDLSDVKKLNVKFSLR 58

  Fly   130 -----DDEVTIFIQGLPETNTQ---------------------VQKATRKLVQAYQQRYNLQPYE 168
                 ||:|...::|..||.:.                     .:....|||.|.          
Zfish    59 NPSQPDDDVCYIVRGKAETLSSCNFNHTSKTILVIHGWTVSGLFESWVEKLVAAL---------- 113

  Fly   169 TTDYSNEEQSQRSSSEEQQTQRRKQNGEQDDTKTGDLIVIQLGNAIEDFEQYATLNIERLGEIIG 233
               |:.|                         |..::||:...:..:|....|..|.:.:|..||
Zfish   114 ---YNRE-------------------------KDANVIVVDWLDTAQDHYVVAAQNTKMVGREIG 150

  Fly   234 NRLVELTNTVNVPQEIIHLIGSGPAAHVAGVAGRQFTRQTGHKLRRITALDP-------TKIYGK 291
            ..:..:..|.|||.|.:||||....|||||.||    ..|.:|:.|||.|||       ...:|:
Zfish   151 LFIDWIEETSNVPLENLHLIGYSLGAHVAGFAG----SHTTNKIGRITGLDPAGPDFEGVHAHGR 211

  Fly   292 PEERLTGLARGDADFVDAIHTSAYG-----MGTSQRLANVDFFPNGPSTGVPGADNVVEATMRAT 351
                   |:..||.|||.:||...|     :|..|.:.:||.:|||.|. .||. |:..|..:..
Zfish   212 -------LSPDDAHFVDVLHTFTRGSLGLSIGIEQPVGHVDIYPNGGSF-QPGC-NLRGALEKMA 267

  Fly   352 RY--FA--ESVRPGNERNFPSVAASSYQEYKQNKGY 383
            .|  ||  .::|..:||:......|...|....:.|
Zfish   268 SYGIFAINNAIRCEHERSIHLFIDSLLNEEAAGRAY 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 81/331 (24%)
Abhydrolase <221..407 CDD:304388 60/179 (34%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 79/308 (26%)
Pancreat_lipase_like 51..347 CDD:238363 78/304 (26%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.