DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and Chi3l1

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_001296749.1 Gene:Chi3l1 / 89824 RGDID:620874 Length:391 Species:Rattus norvegicus


Alignment Length:385 Identity:153/385 - (39%)
Similarity:234/385 - (60%) Gaps:20/385 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EASSEGRVVCYYTNWSVYRPGTAKFNPQNINPYLCTHLVYAFGGFTKDNQMKPFDKYQDIEQGGY 89
            ::.|..::||||||||.||.|.....|..::..||||::|:|...:  |......::.|:..  |
  Rat    25 QSCSAYKLVCYYTNWSQYREGNGSCFPDALDHSLCTHIIYSFANIS--NNKLSTSEWNDVTL--Y 85

  Fly    90 AKFTGLKTYNKQLKTMIAIGGWNEASSRFSPLVASNERRQQFIKNILKFLRQNHFDGIDLDWEYP 154
            .....|||.|.:|||::::|||:..|.|||.:|::.:.|:.|::::..|||...|||:||.|.||
  Rat    86 GMLNTLKTRNPRLKTLLSVGGWSFGSERFSRIVSNAKSRKTFVQSVAPFLRTYGFDGLDLAWLYP 150

  Fly   155 AHREGGKSRDRDNYAQFVQELRAEFEREAEKTGRTRLLLTMAVPAGIEYIDKGYDVPKLNKYLDW 219
            .      .:|:.::...::||:|||.:|.: .|..:|||:.||.||...:|.||||.::.::||:
  Rat   151 G------PKDKQHFTTLIKELKAEFTKEVQ-PGTEKLLLSAAVSAGKVTLDSGYDVAQIAQHLDF 208

  Fly   220 FNVLTYDFHSSHEPSVNHHAPLYSLEEDSEYNYDAELNIDYSIKYYLKAGADRDKLVLGIPTYGR 284
            .|::|||||.:...:..||:||:..::|:  ..|...|:||.:.|.|:.||..:|||:||||:|:
  Rat   209 INLMTYDFHGTWRHTTGHHSPLFRGQQDT--GPDRFSNVDYGVGYMLRLGAPTNKLVMGIPTFGK 271

  Fly   285 SYTLINEESTELGAPAEGPGEQGDATREKGYLAYYEICQTLKDDPEWTVVQPNANVMGPYAYRRN 349
            |:||.:.|: ::|||..|.|..|..|:|||.|||||||..|:......::....    |:|.:.|
  Rat   272 SFTLASSEN-QVGAPITGSGLPGRYTKEKGTLAYYEICDFLRGAEVHRILGQQV----PFATKGN 331

  Fly   350 QWVGYDDEAIVRKKAEYVVAQGLGGIMFWAIDNDDFRGTCNGK--PYPLIEAAKEAMVEA 407
            |||||||...|:.|.:|:..:.|.|.|.||:|.|||||:..|.  .:||..|.|||:..|
  Rat   332 QWVGYDDPESVKNKVKYLKNKQLAGAMVWAVDLDDFRGSFCGHNVHFPLTNAIKEALAVA 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 139/351 (40%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 150/373 (40%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
Chi3l1NP_001296749.1 Glyco_18 31..365 CDD:214753 139/351 (40%)
GH18_chitolectin_chitotriosidase 32..388 CDD:119351 150/373 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.