DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and AT4G19820

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_001320000.1 Gene:AT4G19820 / 827726 AraportID:AT4G19820 Length:368 Species:Arabidopsis thaliana


Alignment Length:398 Identity:113/398 - (28%)
Similarity:178/398 - (44%) Gaps:50/398 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TLFLLCALAYCINEASSEGRVVCYYTNWSVYRPGTAKFNPQNINPYLCTHLVYAFGGFTKDNQMK 76
            |.||...|.:      |..:.|...|.|.    ..::.....|:..|.|||..||...   |.: 
plant    10 TFFLSLLLRF------SSAQTVVKATYWF----AESESPLAQIDSSLFTHLFCAFADI---NTL- 60

  Fly    77 PFDKYQDI----EQGGYAKFT-GLKTYNKQLKTMIAIGGWNEASSRFSPLVASNERRQQFIKNIL 136
               .||.|    .:..::.|| .::..|..:||:::|||....:..|:.:.::...|:.||.:.:
plant    61 ---TYQVIVSSRNKPKFSTFTQTVRRRNPTVKTLLSIGGDFTYNFAFASMASNPTSRKLFISSSI 122

  Fly   137 KFLRQNHFDGIDLDWEYPAHREGGKSRDRDNYAQFVQELRAEFEREAEKTGRTRLLLTMAVPAGI 201
            |..|...|.|:||:|:||:     .:.:.||:.:.::|.|...|.||..:|:.|||||.||....
plant   123 KLARSCGFHGLDLNWKYPS-----ITTEMDNFGKLLREWRLAVEAEARSSGKPRLLLTAAVFYSY 182

  Fly   202 EYIDKGYDVPKLNKYLDWFNVLTYDFHSSHEPSVN-HHAPLYSLEEDSEYNYDAELNIDYSIKYY 265
            .|....:.|..:...|||.|::.|||:.|....|. ..||||.........       |..::.:
plant   183 SYYSVLHPVNAVADSLDWVNLVAYDFYESGSSRVTCSPAPLYDPITTGPSG-------DAGVRAW 240

  Fly   266 LKAGADRDKLVLGIPTYGRSYTLINEESTELGAPAEGPGEQGDATREKGYLAYYEICQTLKDDPE 330
            .:||....|.|||.|.||.::.|.:.::....|.:.||....|     |.:.|.:|.:.:.|:..
plant   241 TQAGLPAKKAVLGFPLYGYAWCLTDAKNHNYYANSSGPAISPD-----GSIGYDQIRRFIVDNKA 300

  Fly   331 WTVVQPNANVMGPYAYRRNQWVGYDDEAIVRKKAEYVVAQGLGGIMFWAIDNDDFRGTCNGKPYP 395
            ..|.  |:|::..|.|.:..|:||||...:..|.:|...:||.|...|.|..||     |.:   
plant   301 TMVY--NSNLVQNYCYAKKTWIGYDDNQSIVMKVKYAKQRGLLGYFSWHIGADD-----NSR--- 355

  Fly   396 LIEAAKEA 403
            |..||.:|
plant   356 LSRAASQA 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 101/357 (28%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 108/378 (29%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
AT4G19820NP_001320000.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.