DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and AT4G19770

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_193712.2 Gene:AT4G19770 / 827721 AraportID:AT4G19770 Length:261 Species:Arabidopsis thaliana


Alignment Length:279 Identity:79/279 - (28%)
Similarity:127/279 - (45%) Gaps:21/279 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LVASNERRQQFIKNILKFLRQNHFDGIDLDWEYPAHREGGKSRDRDNYAQFVQELRAEFEREAEK 185
            :.:|:..|:.||.:.:...|...|||:|||||||.:     :.:..::|:.::|.|...:.||..
plant     1 MASSSYGRKSFILSTISIARSYGFDGLDLDWEYPRN-----AAEMSDFAELLKEWRYAVQGEAYS 60

  Fly   186 TGRTRLLLTMAVPAGIEYIDKGYDVPKLNKYLDWFNVLTYDFHSSHEPSVNHHAPLYSLEEDSEY 250
            :....|:||..|.....|....|.|..:::.|||.|:..|||:......|........|:.|...
plant    61 SELPVLILTATVYYSSNYNGVVYPVKFISELLDWVNIKAYDFYGPGCTEVTGPPAALYLQSDGPS 125

  Fly   251 NYDAELNIDYSIKYYLKAGADRDKLVLGIPTYGRSYTLINEESTELGAPAEGPGEQGDATREKGY 315
            .       |..:|.::.||...:|.|||.|.||.::||.:.::........||     |..:.|.
plant   126 G-------DSGVKDWIDAGLPAEKAVLGFPYYGWAWTLADPKNHGYYVDTTGP-----AISDDGE 178

  Fly   316 LAYYEICQTLKDDPEWTVVQPNANVMGPYAYRRNQWVGYDDEAIVRKKAEYVVAQGLGGIMFWAI 380
            ::|.:: :|...|.:.|.|..|. |:|.|.|....|:|||.|..:..|..|...:||.|...|.:
plant   179 ISYSQL-KTWIVDNKATTVHDNI-VIGDYCYAGTTWIGYDSEESIVTKVIYAKQKGLLGYFSWQV 241

  Fly   381 DNDDFR--GTCNGKPYPLI 397
            ..||..  .:....||.::
plant   242 GGDDKSELSSAGSSPYHIL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 75/261 (29%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 79/279 (28%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
AT4G19770NP_193712.2 GH18_chitinase-like <1..250 CDD:299167 77/267 (29%)
Glyco_18 <1..244 CDD:214753 75/261 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.