DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and AT4G19760

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_193711.2 Gene:AT4G19760 / 827720 AraportID:AT4G19760 Length:369 Species:Arabidopsis thaliana


Alignment Length:341 Identity:93/341 - (27%)
Similarity:157/341 - (46%) Gaps:39/341 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 INPYLCTHLVYAFG---GFTKDNQMKPFDKYQDIEQGGYAKFT-GLKTYNKQLKTMIAIGGWNEA 114
            |:..|.|||..||.   ..|.:..:...:.||      ::.|| .:|..|..::|:::|||.:..
plant    40 IDSTLFTHLFCAFADVDSSTHEVTISAANSYQ------FSSFTETVKEKNTDVQTLLSIGGKDAD 98

  Fly   115 SSRFSPLVASNERRQQFIKNILKFLRQNHFDGIDLDWEYPAHREGGKSRDRDNYAQFVQELRAEF 179
            .:..:.:.::::.|:.||.:.:...|:..|.|:||.||||::     ..:..|:.:.::|.||..
plant    99 KAVLASMASNSKNRKAFIDSSIDIARKKDFYGLDLAWEYPSN-----DVEMTNFGKLLEEWRAAV 158

  Fly   180 EREAEKTGRTRLLLTMAVPAGIEYIDKGYDVPKLNKYLDWFNVLTYDFHS------SHEPSVNHH 238
            ..|::||.:..||||.||....:|....|.|..:...||:.|::.|||:.      :..|:...|
plant   159 VEESDKTNQLPLLLTAAVYYSPQYDGVEYPVKAIADNLDFVNIMAYDFYGPGWSPVTGPPAALFH 223

  Fly   239 APLYSLEEDSEYNYDAELNIDYSIKYYL-KAGADRDKLVLGIPTYGRSYTLINEESTELGAPAEG 302
            .|          :..|..:.:..::.:| :|.....|.|||.|..|.::||.:.|:....|..:|
plant   224 DP----------SNPAGRSGNSGLRKWLDEAKLPPKKAVLGFPYCGWAWTLEDAENNGYDAATDG 278

  Fly   303 PGEQGDATREKGYLAYYEICQTLKDDPEWTVVQPNANVMGPYAYRRNQWVGYDDEAIVRKKAEYV 367
            .....|     |.:.|.:|...:.|:...|...|  .|:|.|.|..|.|:||||...:..|.:|.
plant   279 AAISPD-----GSITYAKIRNYIVDNGAATFHDP--AVIGFYCYVGNTWIGYDDNQSIVYKVKYA 336

  Fly   368 VAQGLGGIMFWAIDND 383
            ...||.|...|.:..|
plant   337 KFTGLLGYFSWHVGAD 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 92/339 (27%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 93/341 (27%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
AT4G19760NP_193711.2 GH18_plant_chitinase_class_V 11..358 CDD:119358 93/341 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.