DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and Ctbs

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_001280601.1 Gene:Ctbs / 74245 MGIID:1921495 Length:366 Species:Mus musculus


Alignment Length:330 Identity:78/330 - (23%)
Similarity:124/330 - (37%) Gaps:71/330 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GLKTYN----KQLKTMIAIGGWNE-----ASSRFSPLVASNE----------RRQQFIKNILKFL 139
            |.||:.    .|:.|:.|.|.::.     |.|:.:.:|...:          .|..:|...:...
Mouse    50 GQKTWKSYDWSQITTVAAFGKYDPELMCYAHSKGARVVLKGDISLKNIIDPTFRASWIAQKVDLA 114

  Fly   140 RQNHFDGIDLDWEYPAHREGGKSRDRDNYAQFVQELRAEFEREAEKTGRTRLLLTMAVPAGIEYI 204
            :..:.|||::|.|...:   ..|.:.:.....|:|....|:||.|.:     .:|..|....:.|
Mouse   115 KAQYMDGINIDIEQEVN---CSSPEYEALTALVKETTESFQREIEGS-----QVTFDVAWSPKRI 171

  Fly   205 DKG-YDVPKLNKYLDWFNVLTYDFHSS--HEPSVNHHAPLYSLEEDSEYNYDAELNIDYSIKYYL 266
            ||. |:...:....|:..|::||..|.  .|.....:||         ||......||     |:
Mouse   172 DKRCYNYTGIADACDFLFVMSYDEQSQIWSECIAAANAP---------YNQTLTGYID-----YI 222

  Fly   267 KAGADRDKLVLGIPTYGRSYTLINEESTELGAPAEGPGEQGDATREKGYLAYYEICQTLKDDPEW 331
            |.|....|||:|:|.||..|..:|....::....:.|......:...|:...|::          
Mouse   223 KMGISPKKLVMGVPWYGYDYICLNLSKDDICTITKVPFRGAPCSDAAGHQVPYKV---------- 277

  Fly   332 TVVQPNANVMGP----------YAYR----RNQWVGYDDEAIVRKKAEYVVAQGLGGIMFW---A 379
            .:.|.|.:|.|.          |.|:    |...|.||:...:..||.||...||.||..|   .
Mouse   278 IMKQVNGSVSGSQWNKDQQAPYYNYKDPAGRFHQVWYDNPQSISLKAAYVKNYGLRGIGMWNANC 342

  Fly   380 IDNDD 384
            :|..|
Mouse   343 LDYSD 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 77/327 (24%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 78/330 (24%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
CtbsNP_001280601.1 GH18_chitobiase 24..362 CDD:119354 78/330 (24%)
Glyco_18 <99..342 CDD:214753 66/274 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.