DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht6 and Muc26B

DIOPT Version :9

Sequence 1:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster
Sequence 2:NP_652552.1 Gene:Muc26B / 50424 FlyBaseID:FBgn0040950 Length:471 Species:Drosophila melanogaster


Alignment Length:386 Identity:103/386 - (26%)
Similarity:135/386 - (34%) Gaps:98/386 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   921 IVTVQSKQSTNTRKYASIGRRTTTTTTATPETTTTTTTTTAGTETAKASTTTNNNNNNNSHYNSS 985
            |..|...:.|.|     ...:..||||.||.:.|||||....|.|..|.|||.            
  Fly   108 IAAVPCAEETTT-----CAPQIITTTTCTPASVTTTTTCAPTTTTTCAPTTTT------------ 155

  Fly   986 NNNNNVKLNNQLPTEENITTTPSTTAQSETTTTTNETTEPNESTSTTTTSITNNLHTTTTTPTPI 1050
                              |..|:||.....||||  |..|..:|:...|:.|....|||||..|.
  Fly   156 ------------------TCAPTTTTTCAPTTTT--TCAPTTTTTCAPTTTTTCAPTTTTTCAPT 200

  Fly  1051 VAST-VPTTTANGISSDSLLATELSEASPTHLSPSPDSETST--PTTT-----STTTTEQPELDT 1107
            ..:| .||||.      :...|..:..:||..:....:.|:|  ||||     :||||..|   |
  Fly   201 TTTTCAPTTTT------TCAPTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCAP---T 256

  Fly  1108 TTTTPKTTTTTTTGNNELNDVNNVDEDSEVTKTKTQYKYATTNRRRITTTTTTATKNSNNNNNAE 1172
            ||||...|||||                 ...|.|.....||......|||||....:.......
  Fly   257 TTTTCAPTTTTT-----------------CAPTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCAPT 304

  Fly  1173 AANDASPTTNGLSSLNSIRTNPGRRQPQPEQTQTTTSEPNLSSPRPFGYPRRRTRPTVSTTTTTI 1237
            .....:|||....:                .|.|||..|.:::          |..|.:||||.:
  Fly   305 TTTTCAPTTTTTCA----------------PTTTTTCTPGITT----------TTCTPATTTTCV 343

  Fly  1238 SQTDNDNNTDNNDNETDAVAQVVKKTRLSPGDRPKVSASLPTATAINTRTNTSSLHHQESQ 1298
            .:|.....:.....|...|:.|...::..|.. .||..:.|...|:........|...::|
  Fly   344 PETTTSCASSTTTTECGPVSGVSGSSKARPSS-VKVRPARPVRPAVRPALEIDELSAPKAQ 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753
GH18_chitolectin_chitotriosidase 32..404 CDD:119351
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
Muc26BNP_652552.1 CBM_14 43..86 CDD:279884
CBM_14 415..463 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.